Property Summary

NCBI Gene PubMed Count 11
PubMed Score 19.41
PubTator Score 8.25

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.100 7.9e-06
atypical teratoid / rhabdoid tumor -1.500 5.1e-06
group 4 medulloblastoma -1.200 1.3e-03
primitive neuroectodermal tumor -1.100 3.7e-03
fibroadenoma -1.200 7.9e-03
lung carcinoma -1.400 1.8e-12

Gene RIF (6)

PMID Text
27010858 ARHGAP10 may serve as a tumor suppressor through inactivating Cdc42, as well as inhibiting cell cycle, replication and BER pathways.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20332263 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20158304 In the Australian GWAS, one SNP achieved genomewide significance (p < 5 x 10(-8)) for ND (rs964170 in ARHGAP10 on chromosome 4, p = 4.43 x 10(-8)).
19911011 Observational study of gene-disease association. (HuGE Navigator)
15471851 PS-GAP is a novel regulator of caspase-activated PAK-2

AA Sequence

MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKFAHSLRDFKFE      1 - 70
FIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFRKEQLGAVKEEKKKFDKETEK     71 - 140
NYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTF    141 - 210
YHQGHELAKDFNHYKMELQINIQNTRNRFEGTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPA    211 - 280
PFGSSWVKHYCMYRKAAKKFNMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSL    281 - 350
TMQAFSEEERKQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVV    351 - 420
GVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFIVPAKSGSPES    421 - 490
RVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPTLMRPQEETVAALMDLKFQN    491 - 560
IVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQSKRQGQRTKRPVAVYNLCLELEDGDNPYPSK    561 - 630
EDTPTSSLDSLSSPSPVTTAVPGPPGPDKNHLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNS    631 - 700
AVTPLSPGSSPFPFSPPATVADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGT    701 - 770
LNGKRGLIPQNYVKLL                                                          771 - 786
//

Text Mined References (12)

PMID Year Title
27010858 2016 ARHGAP10, downregulated in ovarian cancer, suppresses tumorigenicity of ovarian cancer cells.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20332263 2010 A genome-wide association study of prognosis in breast cancer.
20158304 2010 A genomewide association study of nicotine and alcohol dependence in Australian and Dutch populations.
20031603 2009 A genome-wide association scan of RR and QT interval duration in 3 European genetically isolated populations: the EUROSPAN project.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471851 2004 Identification and characterization of PS-GAP as a novel regulator of caspase-activated PAK-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11432776 2001 PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.
8288572 1994 Characterization of rhoGAP. A GTPase-activating protein for rho-related small GTPases.