Property Summary

NCBI Gene PubMed Count 52
PubMed Score 99.34
PubTator Score 101.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.300 1.6e-02
dermatomyositis 1.500 2.5e-03
diabetes mellitus -1.500 2.2e-03
osteosarcoma 3.395 2.1e-07

Synonym

Accession Q07960 D3DQQ6
Symbols RHOGAP
RHOGAP1
CDC42GAP
p50rhoGAP

Gene

PDB

1OW3   1TX4   5M6X   5M70   1AM4   1GRN   1RGP   2NGR  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

AA Sequence

MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSSSPELVTHLKWDDPYYDIARH      1 - 70
QIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWL     71 - 140
RDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPRQV    141 - 210
LKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGI    211 - 280
FRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRV    281 - 350
PATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFT    351 - 420
KFLLDHQGELFPSPDPSGL                                                       421 - 439
//

Text Mined References (63)

PMID Year Title