Property Summary

NCBI Gene PubMed Count 19
PubMed Score 99.65
PubTator Score 97.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 8.8e-04
ductal carcinoma in situ 1745 6.1e-03
invasive ductal carcinoma 2950 1.3e-02
Disease Target Count Z-score Confidence
Clubfoot 35 3.186 1.6
Shwachman-Diamond syndrome 16 3.139 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.300 8.8e-04
ductal carcinoma in situ 1.100 6.1e-03
invasive ductal carcinoma 1.400 1.3e-02

Synonym

Accession P53365 B4DX86 B4E306 D3DQT5
Symbols POR1

Gene

PANTHER Protein Class (2)

PDB

1I49   1I4D   1I4L   1I4T   4DCN  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
26296658 The data indicate that arfaptin 2 is the first molecule to regulate NF-kappaB signaling by interacting with the functional IkappaB kinase complex but not by direct inhibiting IKKbeta phosphorylation.
23695357 The binding of arfaptin1, but not arfaptin2, to PI(4)P is regulated by protein kinase D (PKD) mediated phosphorylation at Ser100 within the AH.
23638170 both Arf1 activation and high membrane curvature are required for efficient recruitment of Arfaptin2 to membranes
22679020 The Arl1.Arfaptin-2 BAR structure suggests that one of the two Arl1 molecules competes with Rac1, which binds to the concave face of the Arfaptin-2 BAR homodimer and may hinder its membrane association.
15809304 arfaptin 2 phosphorylation at Ser260 by Akt inhibits PolyQ-huntingtin-induced toxicity by rescuing proteasome impairment
11854752 arfaptin 2 is involved in regulating huntingtin protein aggregation

AA Sequence

MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRH      1 - 70
PSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKY     71 - 140
ESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI    141 - 210
NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVA    211 - 280
IKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ             281 - 341
//

Text Mined References (26)

PMID Year Title
26296658 2015 Dimer of arfaptin 2 regulates NF-?B signaling by interacting with IKK?/NEMO and inhibiting IKK? kinase activity.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23695357 2013 Recruitment of arfaptins to the trans-Golgi network by PI(4)P and their involvement in cargo export.
23638170 2013 Arf1 and membrane curvature cooperate to recruit Arfaptin2 to liposomes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22679020 2012 Structural basis for membrane binding specificity of the Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-2 determined by Arl1 GTPase.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15809304 2005 Phosphorylation of arfaptin 2 at Ser260 by Akt Inhibits PolyQ-huntingtin-induced toxicity by rescuing proteasome impairment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11854752 2002 Arfaptin 2 regulates the aggregation of mutant huntingtin protein.
11478794 2001 Differential binding of arfaptin 2/POR1 to ADP-ribosylation factors and Rac1.
11346801 2001 The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
11303027 2001 ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins.
9312003 1997 A role for POR1, a Rac1-interacting protein, in ARF6-mediated cytoskeletal rearrangements.
9038142 1997 Arfaptin 1, a putative cytosolic target protein of ADP-ribosylation factor, is recruited to Golgi membranes.
8670882 1996 Identification of a novel Rac1-interacting protein involved in membrane ruffling.