Property Summary

NCBI Gene PubMed Count 19
PubMed Score 109.53
PubTator Score 97.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 8.8e-04
ductal carcinoma in situ 1745 6.1e-03
invasive ductal carcinoma 2951 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Clubfoot 39 3.114 1.6
Shwachman-Diamond syndrome 17 3.105 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
ductal carcinoma in situ 1.100 6.1e-03
invasive ductal carcinoma 1.400 1.3e-02
lung cancer 1.300 8.8e-04

Gene RIF (6)

AA Sequence

MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRH      1 - 70
PSHSTTPSGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSRTVDLELELQIELLRETKRKY     71 - 140
ESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSI    141 - 210
NTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVA    211 - 280
IKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ             281 - 341
//

Text Mined References (26)

PMID Year Title