Property Summary

NCBI Gene PubMed Count 35
PubMed Score 20.57
PubTator Score 29.54

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.153 7.6e-03
lung adenocarcinoma 1.200 1.9e-05

Gene RIF (11)

PMID Text
25397679 ARFGAP1 is found associated with lipid droplets at steady state in some but not all hepatocytes.
24623438 ARFGAP1 is a host factor for Hepatitis C Virus RNA replication, and is hijacked by HCV NS5A to remove COPI cargo Sac1 from the site of HCV replication to maintain high levels of PI4P.
22423108 ArfGAP1 is identified as the first GTPase activating protein (GAP) for leucine-rich repeat kinase 2 (LRRK2).
21499258 role of ARFGAP1 in AP-2-regulated endocytosis has mechanistic parallels with its roles in COPI transport, as both its GAP activity and coat function contribute to promoting AP-2 transport
19299515 ArfGAP1, ArfGAP2, and ArfGAP3 have overlapping roles in regulating COPI function in Golgi-to-ER retrograde transport.
19055691 catalytic amounts of Arf1GAP1 significantly reduce the yield of purified COPI vesicles
19015319 Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking
18541532 coatomer is an allosteric regulator of Arf GAP1
16571680 SMAP2 functions in the retrograde, early endosome-to-trans golig network pathway in a clathrin- and AP-1-dependent manner.
16316994 ArfGAP1 interacts with the Golgi through multiple hydrophobic motifs and that alternative modes of interaction may exist in tissue-specific ArfGAP1 isoforms.
15246431 The small GTPases of the Ras superfamily mediate numerous biological processes through their ability to cycle between an inactive GDP-bound and an active GTP-bound form.

AA Sequence

MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDI      1 - 70
ELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAEGREWSLESSPAQNWTPPQPR     71 - 140
TLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQGNRYVGFGNTPPPQKKEDDFLNNAMSSLYSG    141 - 210
WSSFTTGASRFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQ    211 - 280
GVGSKGWRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWT    281 - 350
CADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW                  351 - 406
//

Text Mined References (43)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25397679 2014 ARFGAP1 is dynamically associated with lipid droplets in hepatocytes.
24623438 2014 Hepatitis C virus NS5A hijacks ARFGAP1 to maintain a phosphatidylinositol 4-phosphate-enriched microenvironment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22423108 2012 ArfGAP1 is a GTPase activating protein for LRRK2: reciprocal regulation of ArfGAP1 by LRRK2.
22363216 2012 GTPase activity and neuronal toxicity of Parkinson's disease-associated LRRK2 is regulated by ArfGAP1.
21499258 2011 ARFGAP1 promotes AP-2-dependent endocytosis.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19299515 2009 Three homologous ArfGAPs participate in coat protein I-mediated transport.
19055691 2009 ArfGAP1 activity and COPI vesicle biogenesis.
19015319 2008 Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18541532 2008 Kinetic analysis of Arf GAP1 indicates a regulatory role for coatomer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16956762 2006 Insights into COPI coat assembly and function in living cells.
16571680 2006 SMAP2, a novel ARF GTPase-activating protein, interacts with clathrin and clathrin assembly protein and functions on the AP-1-positive early endosome/trans-Golgi network.
16316994 2006 Golgi localization determinants in ArfGAP1 and in new tissue-specific ArfGAP1 isoforms.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15246431 2004 GAP control: regulating the regulators of small GTPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379802 2002 ARFGAP1 promotes the formation of COPI vesicles, suggesting function as a component of the coat.
12181329 2002 Casein kinase I regulates membrane binding by ARF GAP1.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11703931 2001 KDEL-cargo regulates interactions between proteins involved in COPI vesicle traffic: measurements in living cells using FRET.
11210549 2001 Expression, purification, and properties of ADP-ribosylation factor (ARF) GTPase activating protein-1.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10704287 2000 Characterization, chromosomal assignment, and tissue expression of a novel human gene belonging to the ARF GAP family.
9733781 1998 Requirement for both the amino-terminal catalytic domain and a noncatalytic domain for in vivo activity of ADP-ribosylation factor GTPase-activating protein.
9476900 1998 Structure of the guanine nucleotide exchange factor Sec7 domain of human arno and analysis of the interaction with ARF GTPase.
9405360 1997 The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1.
8533093 1995 The ARF1 GTPase-activating protein: zinc finger motif and Golgi complex localization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7969419 1994 Mechanisms of intracellular protein transport.