Property Summary

NCBI Gene PubMed Count 29
PubMed Score 21.89
PubTator Score 37.35

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (7)

PMID Text
26000619 GORAB missense mutation disrupt ARF5 binding in Golgi apparatus in patients, with genetic skin diseases.
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 5 (ARF5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22815487 BRAG2 acts at clathrin-coated pits to promote integrin internalization by activating Arf5 and suggest a previously unrecognized role for Arf5 in clathrin-mediated endocytosis of specific cargoes.
22573888 a novel molecular mechanism of circular dorsal ruffles ring size control through the ARAP1-Arf1/5 pathway.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22185782 The lipid droplets deposition and the cellular triacylglycerol content are significantly increased by siRNA-mediated depletion of Arf5.
22105072 a crucial role for class II Arf proteins (Arf4 and Arf5) in the dengue flavivirus life cycle

AA Sequence

MGLTVSALFSRIFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELT     71 - 140
DKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELSKR                                  141 - 180
//

Text Mined References (32)

PMID Year Title
26000619 2015 GORAB Missense Mutations Disrupt RAB6 and ARF5 Binding and Golgi Targeting.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23532257 2013 Genome-wide association study in a Chinese population identifies a susceptibility locus for type 2 diabetes at 7q32 near PAX4.
22815487 2012 BRAG2/GEP100/IQSec1 interacts with clathrin and regulates ?5?1 integrin endocytosis through activation of ADP ribosylation factor 5 (Arf5).
22573888 2012 ARAP1 regulates the ring size of circular dorsal ruffles through Arf1 and Arf5.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22185782 2011 GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
22105072 2012 Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses.
21269460 2011 Initial characterization of the human central proteome.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17555535 2007 Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta.
17030804 2006 Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11926829 2002 Site-specific cross-linking reveals a differential direct interaction of class 1, 2, and 3 ADP-ribosylation factors with adaptor protein complexes 1 and 3.
11535061 2001 Arfophilin is a common target of both class II and class III ADP-ribosylation factors.
10828067 2000 Interaction of GRASP, a protein encoded by a novel retinoic acid-induced gene, with members of the cytohesin family of guanine nucleotide exchange factors.
10749932 2000 A new paxillin-binding protein, PAG3/Papalpha/KIAA0400, bearing an ADP-ribosylation factor GTPase-activating protein activity, is involved in paxillin recruitment to focal adhesions and cell migration.
10593962 1999 Identification of arfophilin, a target protein for GTP-bound class II ADP-ribosylation factors.
10589680 1999 Phosphatidylinositol 4-phosphate 5-kinase alpha is a downstream effector of the small G protein ARF6 in membrane ruffle formation.
10022920 1999 Identification of a new Pyk2 target protein with Arf-GAP activity.
9169151 1997 Localization and characterization of the human ADP-ribosylation factor 5 (ARF5) gene.
9038142 1997 Arfaptin 1, a putative cytosolic target protein of ADP-ribosylation factor, is recruited to Golgi membranes.
8491770 1993 Two distinct populations of ARF bound to Golgi membranes.
8355790 1993 Coated vesicle assembly in the Golgi requires only coatomer and ARF proteins from the cytosol.
2105501 1990 ADP-ribosylation factor is functionally and physically associated with the Golgi complex.
1993656 1991 Molecular identification of ADP-ribosylation factor mRNAs and their expression in mammalian cells.
1447192 1992 Human and Giardia ADP-ribosylation factors (ARFs) complement ARF function in Saccharomyces cerevisiae.