Property Summary

NCBI Gene PubMed Count 33
PubMed Score 170.96
PubTator Score 32.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.342 1.4e-03
astrocytoma -1.400 5.0e-04
posterior fossa group B ependymoma -1.800 4.6e-07
cutaneous lupus erythematosus 1.200 2.8e-03
glioblastoma -2.400 2.7e-06
oligodendroglioma -1.300 2.2e-20
osteosarcoma 2.453 4.7e-07
medulloblastoma -2.400 4.6e-07
atypical teratoid / rhabdoid tumor -2.200 2.9e-07
medulloblastoma, large-cell -2.300 2.4e-04
primitive neuroectodermal tumor -2.100 8.7e-05
Duchenne muscular dystrophy 1.082 5.0e-06
juvenile dermatomyositis 1.043 2.8e-09
intraductal papillary-mucinous adenoma (... -1.200 2.1e-04
diabetes mellitus 1.200 8.0e-03
pediatric high grade glioma -1.600 2.5e-04
pilocytic astrocytoma -1.300 1.9e-03
Pick disease -1.200 7.8e-04
Breast cancer 1.200 2.6e-13
Subcutaneous panniculitis-like T-cell ly... 1.100 3.6e-03
ovarian cancer 2.800 2.1e-07

Protein-protein Interaction (5)

Gene RIF (8)

PMID Text
26330566 observations indicate that Arf1 and Arf3 as well as Arf6 play important roles in cytokinesis.
26067373 activated ARF3 is associated with Unc93B1 and TLR9, suggesting that ARF3 conducts TLR9 trafficking by forming the TLR9-Unc93B1-ARF3 complex.
23783033 ARF1+ARF3 are required for integrity of recycling endosomes but are involved in distinct transport pathways: they are required for the transferrin recycling pathway from endosomes to the plasma membrane.
22971977 ARF1 and ARF3 are redundantly required for the integrity of recycling endosomes
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20357002 These results suggest that Arf3 plays a unique function at the trans-Golgi network that likely involves recruitment by a specific receptor.
19913121 Observational study of gene-disease association. (HuGE Navigator)
12135740 expression and subcellular redistribution by heregulin

AA Sequence

MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGG      1 - 70
QDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEIT     71 - 140
DKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK                                 141 - 181
//

Text Mined References (36)

PMID Year Title
26330566 2016 Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.
26067373 2015 ADP-Ribosylation Factor 3 Mediates Cytidine-Phosphate-Guanosine Oligodeoxynucleotide-Induced Responses by Regulating Toll-Like Receptor 9 Trafficking.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
23783033 2013 ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22971977 2012 ARF1 and ARF3 are required for the integrity of recycling endosomes and the recycling pathway.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20357002 2010 Arf3 is activated uniquely at the trans-Golgi network by brefeldin A-inhibited guanine nucleotide exchange factors.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17555535 2007 Specificity, promiscuity and localization of ARF protein interactions with NCS-1 and phosphatidylinositol-4 kinase-III beta.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16541075 2006 The finished DNA sequence of human chromosome 12.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12135740 2002 Heregulin promotes expression and subcellular redistribution of ADP-ribosylation factor 3.
12090300 2002 Mutation analysis of 12 candidate genes for distal hereditary motor neuropathy type II (distal HMN II) linked to 12q24.3.
10828067 2000 Interaction of GRASP, a protein encoded by a novel retinoic acid-induced gene, with members of the cytohesin family of guanine nucleotide exchange factors.
10749927 2000 A family of ADP-ribosylation factor effectors that can alter membrane transport through the trans-Golgi.
10623590 2000 Interaction of the PDZ domain of human PICK1 with class I ADP-ribosylation factors.
10506747 1999 Arf proteins bind to mitotic kinesin-like protein 1 (MKLP1) in a GTP-dependent fashion.
10413101 1999 Arfaptin 1 forms a complex with ADP-ribosylation factor and inhibits phospholipase D.
9038142 1997 Arfaptin 1, a putative cytosolic target protein of ADP-ribosylation factor, is recruited to Golgi membranes.
8947846 1996 Structure and intracellular localization of mouse ADP-ribosylation factors type 1 to type 6 (ARF1-ARF6).
8661066 1996 Assignment of human ADP ribosylation factor (ARF) genes ARF1 and ARF3 to chromosomes 1q42 and 12q13, respectively.
8491770 1993 Two distinct populations of ARF bound to Golgi membranes.
8473323 1993 Characterization of the human ADP-ribosylation factor 3 promoter. Transcriptional regulation of a TATA-less promoter.
8355790 1993 Coated vesicle assembly in the Golgi requires only coatomer and ARF proteins from the cytosol.
2474826 1989 Molecular cloning, characterization, and expression of human ADP-ribosylation factors: two guanine nucleotide-dependent activators of cholera toxin.
2105501 1990 ADP-ribosylation factor is functionally and physically associated with the Golgi complex.
1744102 1991 Isolation and characterization of the human gene for ADP-ribosylation factor 3, a 20-kDa guanine nucleotide-binding protein activator of cholera toxin.
1577740 1992 Characterization of the human gene encoding ADP-ribosylation factor 1, a guanine nucleotide-binding activator of cholera toxin.
1447192 1992 Human and Giardia ADP-ribosylation factors (ARFs) complement ARF function in Saccharomyces cerevisiae.