Property Summary

NCBI Gene PubMed Count 145
PubMed Score 20.96
PubTator Score 302.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 4.91 2.5
psoriasis 6685 3.32 1.7

Expression

  Differential Expression (32)

Disease log2 FC p
Rheumatoid Arthritis 2.500 1.8e-02
hepatocellular carcinoma -1.800 1.9e-02
urothelial carcinoma -2.500 5.9e-03
malignant mesothelioma -3.000 9.7e-09
psoriasis -2.200 2.7e-06
cutaneous lupus erythematosus 2.500 6.2e-05
atypical teratoid / rhabdoid tumor -1.200 6.2e-03
medulloblastoma -1.200 2.1e-02
acute quadriplegic myopathy 1.417 1.1e-05
tuberculosis -2.000 1.0e-02
non-small cell lung cancer -2.038 2.2e-08
intraductal papillary-mucinous adenoma (... 2.300 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.9e-02
colon cancer 2.300 2.0e-02
lung cancer -2.200 4.8e-04
pancreatic cancer 1.800 2.4e-04
fibroadenoma 2.600 2.5e-02
interstitial cystitis 3.700 3.1e-03
cystic fibrosis 2.100 8.1e-04
lung adenocarcinoma -1.100 5.2e-04
aldosterone-producing adenoma -1.314 4.6e-02
inflammatory breast cancer -4.300 1.5e-03
lung carcinoma -3.800 3.7e-16
breast carcinoma -1.100 6.7e-04
spina bifida -2.644 4.1e-02
gastric carcinoma 2.400 3.2e-02
mucosa-associated lymphoid tissue lympho... -2.626 2.6e-02
ulcerative colitis 2.100 4.8e-05
ovarian cancer 2.200 8.6e-03
pituitary cancer -3.300 2.3e-07
chronic rhinosinusitis -2.494 4.3e-02
head and neck cancer 1.500 2.1e-02

 CSPA Cell Line (3)

Gene RIF (113)

PMID Text
26527289 Our findings implicate amphiregulin as a critical mediator of the estrogen response in ERalpha-positive breast cancer
26503469 High Amphiregulin enhances intercellular adhesion molecule-1 expression and promotes tumor metastasis in osteosarcoma.
26451607 High expression of amphiregulin is associated with hepatocellular carcinoma.
26234682 results demonstrate that AREG controls G2/M progression and cytokinesis in keratinocytes via activation of a FoxM1-dependent transcriptional program, suggesting new avenues for treatment of epithelial cancer
26201903 Findings show the involvement of amphiregulin and semaphorin-3A in the improvement of skin innervations and penetration of nerve fibers into the epidermis.
26047642 Bradykinin (BK) stimulation of human airway smooth muscle cell increases amphiregulin secretion in a mechanism dependent on BK-induced COX-2 expression.
25911599 Altered AREG expression induced by diverse luteinizing hormone receptor reactivity in granulosa cells may provide a useful marker for oocyte developmental competency
25869072 This study shows that TGF-alpha uses common and divergent molecular mediators to regulate E-cadherin expression and cell invasion.
25862847 The applied drugs showed remarkable suppression of mTOR expression, which might delay tumor progression. Interestingly, sorafenib and sunitinib increased AREG in HNSCC 11A and 14C
25825984 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
25744849 AR induces hHSC fibrogenic activity via multiple mitogenic signaling pathways, and is upregulated in murine and human NASH, suggesting that AR antagonists may be clinically useful anti-fibrotics in NAFLD.
25454348 Expression profiling demonstrated that AREG-activated EGFR regulates gene expression differently than EGF-activated EGFR
25261255 AREG induces ovarian cancer cell invasion by down-regulating E-cadherin expression
25203737 AREG rs1615111, located in the AREG genomic region, can significantly define different prognostic cohorts in locally advanced GC
24921206 During high-pressure ventilation, Nrf2 becomes activated and induces AREG, leading to a positive feedback loop between Nrf2 and AREG, which involves the p38 MAPK and results in the expression of cytoprotective genes.
24860833 AREG expression was significantly correlated with Edmondson stage and serum AFP level.
24816162 AREG shedding occurs through a TNF-alpha-converting enzyme-dependent mechanism in diacetyl treated pulmonary epithelial cells.
24196392 IL-1beta-induced amphiregulin release may be involved in the pathogenesis of rheumatoid arthritis.
24092824 Data suggest that AREG (amphiregulin), BTC (betacellulin), and EREG (epiregulin) induced prostaglandin E2 production by induction of COX-2 (prostaglandin-endoperoxide synthase 2) through MAP kinase signaling in granulosa cells.
23975434 aberrantly activated AREG-EGFR signaling is required for CRTC1-MAML2-positive MEC cell growth and survival, suggesting that EGFR-targeted therapies will benefit patients with advanced, unresectable CRTC1-MAML2-positive MEC.
23885463 we did not find a correlation between the presence of a K-ras mutation and the presence of Epiregulin and Amphiregulin in colon cancer tissue.
23851501 Self-reinforcing loop of amphiregulin and Y-box binding protein-1 contributes to poor outcomes in ovarian cancer.
23844004 Exosome-bound WD repeat protein Monad inhibits breast cancer cell invasion by degrading amphiregulin mRNA.
23625463 EREG-AREG and NRG1, which are members of the epidermal growth factor (EGF) family, seem to modulate Behcet's disease susceptibility through main effects and gene-gene interactions
23624749 Promoter methylation of AREG is associated with glioblastoma.
23594797 These findings provide mechanistic insight into the regulation of YAP and AREG by RASSF1A in human multistep hepatocarcinogenesis.
23430747 Human antigen R-mediated mRNA stabilization is required for ultraviolet B-induced autoinduction of amphiregulin in keratinocytes.
23333304 HIV-1 Vif upregulates the expression of amphiregulin (AREG) in Vif-expression T cells
23285165 Regulation of amphiregulin gene expression by beta-catenin signaling in human hepatocellular carcinoma cells.
23263765 AREG plays pro-neoplastic roles in colorectal carcinogenesis
22967896 Amphiregulin is cleaved at Lysine 187, a site homologous to the cleavage site reported in the mouse protein and distinct from the Lysine 184 site previously reported for the human protein.
22825057 AREG functions in a non-cell-autonomous manner to mediate EGF-independent growth and malignant behavior of mammary epithelial cells.
22641668 We conclude that the expression of Amphiregulin in a primary colorectal tumor is useful as an indicator of prognosis and as a predictor of recurrence.
22581387 concentrations in colostrum/milk were higher on days 1 and 2 and rapidly declined to below 1 ng/ml on day 5
22570239 Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling, which has implications in ADPKD cell proliferation
22445895 these data demonstrate a novel function mediated by the intracellular domain of proAREG and suggest a significant role for nuclear envelope-localized proAREG in driving human breast cancer progression.
22438584 proAREG-annexins-ADAM17 complex needs to localize at the cell surface for shedding of proAREG to occur
22425981 These results suggested that pro-AREG monoubiquitination and the subsequent trafficking to intracellular organelles is a novel shedding regulatory mechanism that contributes to the secretion of EGFR ligands in growth factor signaling.
22395988 Low AREG is associated with pancreatic ductal adenocarcinoma.
21917092 AP-1B is required for efficient recycling of amphiregulin to the basolateral surface
21917092 Polarized transport of amphiregulin is dependent on a novel EEXXXL basolateral sorting motif in its cytoplasmic domain
21742971 Lung tumor-associated dendritic cell-derived amphiregulin increased cancer progression.
21653755 AREG expression is essential for efficient hepatitis C virus assembly and virion release.
21514161 Amphiregulin exosomes increase cancer cell invasion.
21454516 AGR2 induction of AREG is mediated by activation of the Hippo signaling pathway co-activator, YAP1.
21439861 may play a significant role in the proliferation of human bone marrow stromal cells
21377153 Oocyte competence is linked to granulosa cell AR secretion.
21302279 AREG functions in regulating the invasive breast cancer phenotype, perhaps through altered signaling that occurs when AREG activates plasma membrane localized epidermal growth factor receptor (EGFR).
21298020 the infection of N. gonorrhoeae causes an alternative amphiregulin processing, subcellular distribution and release in human epithelial cervical cells that likely contribute to the predisposition cellular abnormalitiesof N. gonorrhoeae infections.
21258428 estrogen and progeterone increased cell proliferation in normal gland and mammary cancers through the increased production of amphiregulin
21245963 AREG and GDF15 produced in response to UVB exposure can affect the growth and protein synthesis of lens epithelial cells
21161326 Data suggest that expression status of AR and EPI mRNAs might be evaluated as dynamic predictors of response in KRAS WT patients receiving any cetuximab-based therapy.
21036386 human subjects with asthma contained significantly higher numbers of amphiregulin-producing basophils
20856199 Data suggest that PHD2/HIF-2/amphiregulin signaling has a critical role in the regulation of breast tumor progression and propose PHD2 as a potential tumor suppressor in breast cancer.
20811902 Amphiregulin expression was found to be increased in salivary glands of Sjogren's syndrome patients.
20726858 Data show that blockade of amphiregulin suppressed the activities of EGFR, HER3, and Akt and the expression of amphiregulin itself.
20719813 AREG accumulation is a useful marker of gonadotrophin stimulation and oocyte competence.
20651357 the inhibition of amphiregulin expression, which impairs EGFR response to its exogenously available ligands, may represent an alternative anti-EGFR therapeutic strategy in breast cancer.
20651071 ATP released from tumor cells might exert a tumorigenic action by stimulating the secretion of AREG from dendritic cells.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20567134 is not essential for the induction of contact hypersensitivity
20428186 autocrine human KC growth is highly dependent on the AREG transmembrane precursor protein and strongly suggest a previously unreported function of the metalloproteinase-processed carboxy (C)-terminal domain of AREG
20237496 Observational study of gene-disease association. (HuGE Navigator)
20103632 data build the connection between BRCA1 loss of function and AREG upregulation-a change in gene expression often observed in breast cancer.
19935651 identify the gene for the epidermal growth factor receptor (EGFR) ligand amphiregulin (AREG) as a transcriptional target of YAP, whose induction contributes to YAP-mediated cell proliferation and migration, but not mesenchymal transition.
19915156 Results describe the role of amphiregulin in an experimental model of bleomycin-induced pneumopathy in mice.
19895983 Acute asthma attacks are associated with hypersecretion of EGF and amphiregulin in the airway
19825997 Taken together, we provide evidence that AREG stimulation of EGFR results in high levels of PTHrP gene expression, contributing to cancer-associated bone pathology.
19735466 The results of these studies identify CXCL12 as a novel inducer of amphiregulin ectodomain shedding and show that both basal and CXCL12-mediated amphiregulin shedding are ADAM10- and Src kinase-dependent in non-transformed N15C6 cells
19609315 lentivirus-mediated expression of soluble HB-EGF, but not soluble AREG, strongly enhanced keratinocyte migration, even in the presence of metalloproteinase inhibitors
19587163 may play a significant role in the proliferation of osseous dysplasia
19494503 eosinophils produce and release AREG, and participate in some physiological and pathological conditions in vivo.
19344731 Amphiregulin is a key molecule among epidermal growth factor receptor (EGFR) ligands and may play a pivotal role in the development or maturation of placenta.
19337692 These findings suggest that mitochondrial dysfunction induced Ca(2+) mobilization, and reactive oxygen species overproduction, which modulated the chemo-resistance and migration of hepatoma cells through the induction and activation of amphiregulin.
19070973 Use of AREG as a biomarker in non-small cell lung cancershould be encouraged since AREG is correlated with a poor prognosis, resistance to treatments and to apoptosis.
19003995 Amphiregulin plays a crucial role in UV-induced EGFR activation and is overexpressed in skin cancer cell lines
18955794 interleukin-4 and amphiregulin have roles in the proliferation of human airway smooth muscle cells and cytokine release
18946024 plasma-membrane-anchored growth factor pro-amphiregulin binds A-type lamin and regulates global transcription
18835871 Amphiregulin has a protective effect against apoptosis in the human corpus luteum.
18811692 serum amphiregulin in patients with advanced non-squamous, non-small cell lung cancer
18560449 The expression of amphiregulin was increased in the secretory phase of human endometrium, and may play an important role in human implantation.
18325497 Amphiregulin was expressed most dominantly among EGF receptor ligands tested and may mediate the hCG signal in human oocyte maturation. Elaborate interaction between AR and hCG may be required for an optimal oocyte maturation.
18045238 amphiregulin-specific EGF-R fate results from decreased hSprouty2 degradation and reduced Cbl recruitment to underphosphorylated EGF-R, two effects that impair EGF-R trafficking to lysosomes
17962208 AREG is preferentially expressed in breast tumors co-expressing HER2/HER4. AREG is associated with estradiol receptors, small tumour size, low histoprognostic grading, high HER4 levels.
17960400 TNFalpha may play a key role in cooperation with HB-EGF and AREG in the proliferation of epidermal keratinocytes at the psoriatic skin lesions.
17942395 After exposure to cisplatin, the resistant breast cancer cells secrete amphiregulin protein by short interfering RNA resulting in a nearly complete reversion of the resistant phenotype.
17548638 MIP-3alpha-mediated ERK1/2 activation in Caco-2 cells appeared to require metalloproteinase-dependent release of the endogenous EGFR ligand amphiregulin and transactivation of the EGFR.
17525275 AREG is up-regulated in tumor cells of SCC but not BCC of the skin. AREG is also overexpressed in asymptomatic epidermis adjacent to both SCC and BCC, relative to normal skin.
17035230 Amphiregulin (AR) up-regulates a number of genes involved in cell motility and invasion in MCF10A cells, suggesting that an AR autocrine loop contributes to the aggressive breast cancer phenotype.
16888076 findings demonstrated that PGE2 may mimic LH action at least in part by the activation of amphiregulin and epiregulin biosynthesis in human granulosa cells
16641105 results show that TACE undergoes phosphorylation that regulates release of amphiregulin upon GRP treatment; a signaling cascade of GRP-Src-PI3-K-PDK1-TACE-amphiregulin-EGFR with multiple points of interaction, translocation & phosphorylation is suggested
16470170 Amphiregulin and HB-EGF mediate retinoic acid-mediated epidermal hyperplasia
16336275 HAT induces amphiregulin production through the PAR-2 mediated ERK pathway, and then causes amphiregulin release by a TACE-dependent mechanism
16213893 The mechanism of deoxycholic acid-induced epideermal growth factor receptor activation is ligand-dependent and is controlled, at least in part, at the level of amphiregulin release from the basolateral cell membrane.
16207795 Results suggest that hypoxia promotes intestinal epithelial amphiregulin expression in a CREB-dependent manner, an event that may contribute to increased proliferation.
16088955 Data suggest that parathyroid hormone-induced amphiregulin mRNA expression is mediated primarily through cyclic AMP-protein kinase A-CREB signaling.
15955087 Enhanced transmigration of human neutrophils through polarized epithelial cell monolayers of MDCK cells after administration of AR, further supporting aspecific role for AR in pathogenesis of psoriasis.
15767261 AR and IGF1 cooperate to prevent apoptosis by activating a specific PKC-p90(rsk)-dependent pathway, which leads to Bad and Bax inactivation.
15735670 AREG gene expressed by purified primary myeloma cells, and expression higher than in normal bone marrow (BM) plasma cells or plasmablastic cells; AREG plays an important role in biology of multiple myeloma
15696083 Mast cells secreted amphiregulin on IgE cross-linking, and amphiregulin induced proliferation of lung fibroblasts. Local release of amphiregulin by mast cells could play role in lung fibrosis by promoting proliferation of lung fibroblasts.
15696081 Amphiregulin was secreted by human mast cells after aggregation of FcepsilonRI. Amphiregulin may be new target molecule for treatment of overproduction of sputum in bronchial asthma.
15685553 an early-response growth factor that may contribute to the initial phases of liver regeneration.
15474502 upregulation of the epiregulin and amphiregulin expression is part of the signal transduction pathway which leads to ovulation and luteinization in the human ovary
15284208 AR is under strong regulation by the cAMP pathway in various cell types
15254267 amphiregulin- and ErbB1-dependent mechanism by which autocrine ERK activation is maintained in normal keratinocytes
15186320 epidermal AR expression as a possible mediator of innate cutaneous immunity and epidermal proliferation and also as a potential trigger of both cutaneous psoriasis and psoriatic arthritis.
14633617 Amphiregulin(AR) overexpressing cells (HaCaT-AR) displayed autonomous proliferation in serum-free media. HaCaT-AR cells formed rapidly growing tumors with AR expression similar to keratoacanthoma.
12743035 Data show that in squamous cell carcinoma cells, stimulation with G protein-coupled receptor agonists specifically results in cleavage and release of amphiregulin (AR) by TACE.
12711607 amphiregulin binds to EGF receptor and has a role in stimulation of lung epithelial cells upon exposure to tobacco smoke
12568494 Review. The activation of EGFR in response to smoke involves cleavage of amphiregulin by ADAM 17.
12356750 H358 cells secrete a high level of amphiregulin that, in combination with IGF1, prevents serum deprivation apoptosis
11859273 mRNA expression in atrophic gastritis before and after Helicobacter pylori eradication
11719440 (TARP) expression in prostate cancer cells leads to an increased growth rate and induction of caveolins and amphiregulin.

AA Sequence

MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMP      1 - 70
SSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNR     71 - 140
KKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSA    141 - 210
VILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA                                211 - 252
//

Text Mined References (148)

PMID Year Title
26527289 2015 Amphiregulin Is a Critical Downstream Effector of Estrogen Signaling in ER?-Positive Breast Cancer.
26503469 2015 Amphiregulin enhances intercellular adhesion molecule-1 expression and promotes tumor metastasis in human osteosarcoma.
26451607 2015 Amphiregulin activates regulatory T lymphocytes and suppresses CD8+ T cell-mediated anti-tumor response in hepatocellular carcinoma cells.
26234682 2016 The EGF receptor ligand amphiregulin controls cell division via FoxM1.
26201903 2015 Expression of Neuropeptides, Neurotrophins, and Neurotransmitters in the Skin of Patients with Atopic Dermatitis and Psoriasis.
26047642 2015 Human airway smooth muscle cells secrete amphiregulin via bradykinin/COX-2/PGE2, inducing COX-2, CXCL8, and VEGF expression in airway epithelial cells.
25911599 2015 Altered amphiregulin expression induced by diverse luteinizing hormone receptor reactivity in granulosa cells affects IVF outcomes.
25869072 2015 Transforming growth factor-? induces human ovarian cancer cell invasion by down-regulating E-cadherin in a Snail-independent manner.
25862847 2015 Targeting mTOR and AREG with everolimus, sunitinib and sorafenib in HPV-positive and -negative SCC.
25825984 2015 Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.
25744849 2015 Amphiregulin activates human hepatic stellate cells and is upregulated in non alcoholic steatohepatitis.
25454348 2015 Oncogenic signaling in amphiregulin and EGFR-expressing PTEN-null human breast cancer.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25261255 2014 Amphiregulin induces human ovarian cancer cell invasion by down-regulating E-cadherin expression.
25203737 2014 Single nucleotide polymorphisms in AREG and EREG are prognostic biomarkers in locally advanced gastric cancer patients after surgery with curative intent.
24921206 2014 Interplay between nuclear factor erythroid 2-related factor 2 and amphiregulin during mechanical ventilation.
24860833 2014 Expression and clinical significance of YAP, TAZ, and AREG in hepatocellular carcinoma.
24816162 2014 Diacetyl induces amphiregulin shedding in pulmonary epithelial cells and in experimental bronchiolitis obliterans.
24463227 2014 Amphiregulin.
24196392 2014 TACE-dependent amphiregulin release is induced by IL-1? and promotes cell invasion in fibroblast-like synoviocytes in rheumatoid arthritis.
24092824 2013 EGF-like growth factors induce COX-2-derived PGE2 production through ERK1/2 in human granulosa cells.
23975434 2014 Aberrantly activated AREG-EGFR signaling is required for the growth and survival of CRTC1-MAML2 fusion-positive mucoepidermoid carcinoma cells.
23885463 2013 [Correlation between the presence of Kras mutation and the presence of the proteins epiregulin and amphiregulin in colon cancer tissue].
23851501 2014 Self-reinforcing loop of amphiregulin and Y-box binding protein-1 contributes to poor outcomes in ovarian cancer.
23844004 2013 Exosome-bound WD repeat protein Monad inhibits breast cancer cell invasion by degrading amphiregulin mRNA.
23625463 2013 Gene expression profiling and association studies implicate the neuregulin signaling pathway in Behçet's disease susceptibility.
23624749 2013 Promoter methylation of AREG, HOXA11, hMLH1, NDRG2, NPTX2 and Tes genes in glioblastoma.
23594797 2013 RASSF1A-mediated regulation of AREG via the Hippo pathway in hepatocellular carcinoma.
23430747 2013 Human antigen R-mediated mRNA stabilization is required for ultraviolet B-induced autoinduction of amphiregulin in keratinocytes.
23285165 2012 Regulation of amphiregulin gene expression by ?-catenin signaling in human hepatocellular carcinoma cells: a novel crosstalk between FGF19 and the EGFR system.
23263765 2013 Pro-neoplastic effects of amphiregulin in colorectal carcinogenesis.
22967896 2012 Clarification of the C-terminal proteolytic processing site of human Amphiregulin.
22825057 2012 TAZ induces growth factor-independent proliferation through activation of EGFR ligand amphiregulin.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22641668 2012 Amphiregulin is a prognostic factor in colorectal cancer.
22581387 2012 Clinical significance of amphiregulin and epidermal growth factor in colostrum.
22570239 2012 Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling: implications in ADPKD cell proliferation.
22445895 2012 Nuclear envelope-localized EGF family protein amphiregulin activates breast cancer cell migration in an EGF-like domain independent manner.
22438584 2012 Cell surface annexins regulate ADAM-mediated ectodomain shedding of proamphiregulin.
22425981 2012 Monoubiquitination of pro-amphiregulin regulates its endocytosis and ectodomain shedding.
22395988 2012 Postoperative prognostic predictors of pancreatic ductal adenocarcinoma: clinical analysis and immunoprofile on tissue microarrays.
22184114 2012 AGR2 gene function requires a unique endoplasmic reticulum localization motif.
21917092 2011 Identification of a novel mono-leucine basolateral sorting motif within the cytoplasmic domain of amphiregulin.
21742971 2011 Lung tumor-associated dendritic cell-derived amphiregulin increased cancer progression.
21658434 2011 The multiple roles of amphiregulin in human cancer.
21653755 2011 Hepatitis C virus infection induces the expression of amphiregulin, a factor related to the activation of cellular survival pathways and required for efficient viral assembly.
21514161 2011 Amphiregulin exosomes increase cancer cell invasion.
21454516 2011 The human adenocarcinoma-associated gene, AGR2, induces expression of amphiregulin through Hippo pathway co-activator YAP1 activation.
21439861 2011 Expression and regulation of amphiregulin in Gs?-mutated human bone marrow stromal cells of fibrous dysplasia of mandible.
21377153 2011 Levels of the epidermal growth factor-like peptide amphiregulin in follicular fluid reflect the mode of triggering ovulation: a comparison between gonadotrophin-releasing hormone agonist and urinary human chorionic gonadotrophin.
21302279 2011 Knock-down of amphiregulin inhibits cellular invasion in inflammatory breast cancer.
21298020 2011 Neisseria gonorrhoeae infection induces altered amphiregulin processing and release.
21258428 2010 Amphiregulin mediates estrogen, progesterone, and EGFR signaling in the normal rat mammary gland and in hormone-dependent rat mammary cancers.
21245963 2011 Ultraviolet B-induced expression of amphiregulin and growth differentiation factor 15 in human lens epithelial cells.
21161326 2012 Evolution of the predictive markers amphiregulin and epiregulin mRNAs during long-term cetuximab treatment of KRAS wild-type tumor cells.
21036386 2010 Human basophils express amphiregulin in response to T cell-derived IL-3.
20856199 2011 Prolyl-4-hydroxylase PHD2- and hypoxia-inducible factor 2-dependent regulation of amphiregulin contributes to breast tumorigenesis.
20811902 2010 Expression of pro-inflammatory TACE-TNF-?-amphiregulin axis in Sjögren's syndrome salivary glands.
20726858 2010 Amphiregulin regulates the activation of ERK and Akt through epidermal growth factor receptor and HER3 signals involved in the progression of pancreatic cancer.
20719813 2010 Human oocyte maturation is dependent on LH-stimulated accumulation of the epidermal growth factor-like growth factor, amphiregulin.
20651357 2010 Antisense inhibition of amphiregulin expression reduces EGFR phosphorylation in transformed human breast epithelial cells.
20651071 2010 ATP confers tumorigenic properties to dendritic cells by inducing amphiregulin secretion.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20567134 2010 Amphiregulin is not essential for induction of contact hypersensitivity.
20428186 2010 Amphiregulin carboxy-terminal domain is required for autocrine keratinocyte growth.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20103632 2010 BRCA1 represses amphiregulin gene expression.
19935651 2009 YAP-dependent induction of amphiregulin identifies a non-cell-autonomous component of the Hippo pathway.
19915156 2010 Amphiregulin attenuates bleomycin-induced pneumopathy in mice.
19895983 2009 Tissue remodeling induced by hypersecreted epidermal growth factor and amphiregulin in the airway after an acute asthma attack.
19825997 2009 Reconstitution of amphiregulin-epidermal growth factor receptor signaling in lung squamous cell carcinomas activates PTHrP gene expression and contributes to cancer-mediated diseases of the bone.
19740107 2009 Epidermal growth factor receptor ligands as new extracellular targets for the metastasis-promoting S100A4 protein.
19735466 2009 ADAM-mediated amphiregulin shedding and EGFR transactivation.
19609315 2010 Metalloproteinase-mediated, context-dependent function of amphiregulin and HB-EGF in human keratinocytes and skin.
19587163 2009 Amphiregulin induces proliferative activities in osseous dysplasia.
19494503 2009 Amphiregulin production by human eosinophils.
19344731 2009 Amphiregulin regulates the production of human chorionic gonadotropin in trophoblasts.
19337692 2009 Mitochondrial dysfunction-induced amphiregulin upregulation mediates chemo-resistance and cell migration in HepG2 cells.
19070973 The increasing role of amphiregulin in non-small cell lung cancer.
19003995 2009 UV-induced EGFR signal transactivation is dependent on proligand shedding by activated metalloproteases in skin cancer cell lines.
18955794 2008 The effect of interleukin-4 and amphiregulin on the proliferation of human airway smooth muscle cells and cytokine release.
18946024 2008 Plasma-membrane-anchored growth factor pro-amphiregulin binds A-type lamin and regulates global transcription.
18835871 2009 EGF-like growth factors as LH mediators in the human corpus luteum.
18811692 2008 Clinical significance of pretreatment serum amphiregulin and transforming growth factor-alpha, and an epidermal growth factor receptor somatic mutation in patients with advanced non-squamous, non-small cell lung cancer.
18560449 2008 [Expression of amphiregulin in human endometrium during the menstrual cycle].
18470483 2008 The ADAM17-amphiregulin-EGFR axis in mammary development and cancer.
18437539 2008 Amphiregulin as a novel target for breast cancer therapy.
18398673 2008 Amphiregulin: role in mammary gland development and breast cancer.
18325497 2009 Amphiregulin is much more abundantly expressed than transforming growth factor-alpha and epidermal growth factor in human follicular fluid obtained from patients undergoing in vitro fertilization-embryo transfer.
18045238 2008 EGF and amphiregulin differentially regulate Cbl recruitment to endosomes and EGF receptor fate.
17962208 2008 ErbB/HER ligands in human breast cancer, and relationships with their receptors, the bio-pathological features and prognosis.
17960400 2008 The role of heparin-binding EGF-like growth factor and amphiregulin in the epidermal proliferation of psoriasis in cooperation with TNFalpha.
17942395 2008 Epidermal growth factor receptor pathway analysis identifies amphiregulin as a key factor for cisplatin resistance of human breast cancer cells.
17659070 2007 Estrogen regulation of mammary gland development and breast cancer: amphiregulin takes center stage.
17607000 2007 Cornichon regulates transport and secretion of TGFalpha-related proteins in metazoan cells.
17548638 2007 Macrophage-inflammatory protein-3alpha mediates epidermal growth factor receptor transactivation and ERK1/2 MAPK signaling in Caco-2 colonic epithelial cells via metalloproteinase-dependent release of amphiregulin.
17525275 2007 Differential ErbB1 signaling in squamous cell versus basal cell carcinoma of the skin.
17321672 2007 Amphiregulin: a new growth factor in hepatocarcinogenesis.
17035230 2006 Autocrine and juxtacrine effects of amphiregulin on the proliferative, invasive, and migratory properties of normal and neoplastic human mammary epithelial cells.
16888076 2006 PGE2 up-regulates EGF-like growth factor biosynthesis in human granulosa cells: new insights into the coordination between PGE2 and LH in ovulation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641105 2006 Phosphorylation of TNF-alpha converting enzyme by gastrin-releasing peptide induces amphiregulin release and EGF receptor activation.
16470170 2006 Retinoid-induced epidermal hyperplasia is mediated by epidermal growth factor receptor activation via specific induction of its ligands heparin-binding EGF and amphiregulin in human skin in vivo.
16336275 2005 Human airway trypsin-like protease induces amphiregulin release through a mechanism involving protease-activated receptor-2-mediated ERK activation and TNF alpha-converting enzyme activity in airway epithelial cells.
16213893 2005 Ligand-dependent activation of the epidermal growth factor receptor by secondary bile acids in polarizing colon cancer cells.
16207795 2006 Hypoxia induces epithelial amphiregulin gene expression in a CREB-dependent manner.
16088955 2005 Stimulation of amphiregulin expression in osteoblastic cells by parathyroid hormone requires the protein kinase A and cAMP response element-binding protein signaling pathway.
15955087 2005 Amphiregulin causes functional downregulation of adherens junctions in psoriasis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15767261 2005 Cooperation of amphiregulin and insulin-like growth factor-1 inhibits Bax- and Bad-mediated apoptosis via a protein kinase C-dependent pathway in non-small cell lung cancer cells.
15735670 2005 Expression of EGF-family receptors and amphiregulin in multiple myeloma. Amphiregulin is a growth factor for myeloma cells.
15696083 2005 Amphiregulin expression in human mast cells and its effect on the primary human lung fibroblasts.
15696081 2005 FcepsilonRI-mediated amphiregulin production by human mast cells increases mucin gene expression in epithelial cells.
15685553 2005 Amphiregulin: an early trigger of liver regeneration in mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474502 2004 EGF-like factor epiregulin and amphiregulin expression is regulated by gonadotropins/cAMP in human ovarian follicular cells.
15284208 2004 The epidermal growth factor-like growth factor amphiregulin is strongly induced by the adenosine 3',5'-monophosphate pathway in various cell types.
15254267 2004 Autocrine extracellular signal-regulated kinase (ERK) activation in normal human keratinocytes: metalloproteinase-mediated release of amphiregulin triggers signaling from ErbB1 to ERK.
15186320 2004 Suprabasal expression of human amphiregulin in the epidermis of transgenic mice induces a severe, early-onset, psoriasis-like skin pathology: expression of amphiregulin in the basal epidermis is also associated with synovitis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14633617 2003 Amphiregulin overexpression results in rapidly growing keratinocytic tumors: an in vivo xenograft model of keratoacanthoma.
12743035 2003 TACE cleavage of proamphiregulin regulates GPCR-induced proliferation and motility of cancer cells.
12711607 2003 Tobacco smoke-induced lung cell proliferation mediated by tumor necrosis factor alpha-converting enzyme and amphiregulin.
12568494 2002 Mechanisms by which gram-positive bacteria and tobacco smoke stimulate mucin induction through the epidermal growth factor receptor (EGFR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370739 2002 Transforming growth factor alpha, amphiregulin and cripto-1 are frequently expressed in advanced human ovarian carcinomas.
12356750 2002 Inhibition of apoptosis by amphiregulin via an insulin-like growth factor-1 receptor-dependent pathway in non-small cell lung cancer cell lines.
11942969 2002 Possible autocrine loop of the epidermal growth factor system in patients with benign prostatic hyperplasia treated with finasteride: a placebo-controlled randomized study.
11859273 2002 mRNA expression of EGF receptor ligands in atrophic gastritis before and after Helicobacter pylori eradication.
11719440 2001 T-cell receptor gamma chain alternate reading frame protein (TARP) expression in prostate cancer cells leads to an increased growth rate and induction of caveolins and amphiregulin.
11507076 2001 A subclass of HER1 ligands are prognostic markers for survival in bladder cancer patients.
11494130 2001 A functional screen for genes inducing epidermal growth factor autonomy of human mammary epithelial cells confirms the role of amphiregulin.
11469683 2001 Induction and expression of cyclin D3 in human pancreatic cancer.
11038170 2000 Ectodomain shedding of epidermal growth factor receptor ligands is required for keratinocyte migration in cutaneous wound healing.
10490105 1999 The Wilms tumor suppressor WT1 encodes a transcriptional activator of amphiregulin.
10424781 1999 Production of epidermal growth factor related ligands in tumorigenic and benign human lung epithelial cells.
10389762 1999 Mitogen-activated protein kinase (MAPK) regulates the expression of progelatinase B (MMP-9) in breast epithelial cells.
10085134 1999 A differential requirement for the COOH-terminal region of the epidermal growth factor (EGF) receptor in amphiregulin and EGF mitogenic signaling.
9410906 1997 Transgenic expression of the human amphiregulin gene induces a psoriasis-like phenotype.
7749138 1995 The role of amphiregulin in breast cancer.
7698025 1995 A mapping study of 13 genes on human chromosome bands 4q11-->q25.
7679104 1993 Amphiregulin induces tyrosine phosphorylation of the epidermal growth factor receptor and p185erbB2. Evidence that amphiregulin acts exclusively through the epidermal growth factor receptor at the surface of human epithelial cells.
3413110 1988 Amphiregulin: a bifunctional growth-modulating glycoprotein produced by the phorbol 12-myristate 13-acetate-treated human breast adenocarcinoma cell line MCF-7.
2466334 1989 Structure and function of human amphiregulin: a member of the epidermal growth factor family.
2325643 1990 The amphiregulin gene encodes a novel epidermal growth factor-related protein with tumor-inhibitory activity.
2234093 1990 Structure, expression and function of a schwannoma-derived growth factor.
2017164 1991 A heparin sulfate-regulated human keratinocyte autocrine factor is similar or identical to amphiregulin.
1333777 1992 Colorectum cell-derived growth factor (CRDGF) is homologous to amphiregulin, a member of the epidermal growth factor family.