Property Summary

NCBI Gene PubMed Count 21
PubMed Score 167.80
PubTator Score 75.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.231 2.6e-05
group 4 medulloblastoma -3.000 1.2e-03
atypical teratoid/rhabdoid tumor -2.000 5.9e-03
non-small cell lung cancer -1.503 1.4e-18
posterior fossa group B ependymoma -2.000 9.3e-05
lung adenocarcinoma -1.800 8.1e-17
invasive ductal carcinoma -2.001 3.0e-03
inflammatory breast cancer -1.700 7.7e-07
pituitary cancer -3.300 9.7e-06
Down syndrome -1.100 7.3e-04

Gene RIF (14)

PMID Text
26995091 ARC confers resistance to sunitinib in renal cell carcinoma through alternate angiogenesis pathways
26516611 We tested whether ARC variants are associated with six measures of cognitive functioning in 670 healthy subjects in the Norwegian Cognitive NeuroGenetics (NCNG) by extracting data from its Genome-Wide Association Study (GWAS).
26474411 this is the first report associating an ARC SNP with schizophrenia and supports recent large-scale GWAS findings implicating the ARC complex in schizophrenia risk
26380114 we propose that the peculiar characteristics of Arc protein, such as its optimal expression after ongoing experience or familiar behavior could explain how familiarization and recognition memories are stored and preserved in the mammalian brain--{REVIEW}
26038830 mRNA levels of ARC and SGK1 did not differ significantly between the schizophrenia or control samples.
25748042 Arc is a flexible multi-domain protein that exists in monomeric and oligomeric forms, compatible with a diverse, hub-like role in plasticity-related processes.
25344068 Results show that in response to DNA damage, p53 total levels increase proportionally to the strength of the damage; however, p53 tetramers are formed at a constant rate under the control of ARC protein.
24945773 Degradation of Arc by clathrin-localized Triad3A regulates the availability of synaptic AMPA receptors.
22622366 we report a novel ARC single nucleotide polymorphism associated with a reduced risk of developing Alzheimer disease.
22584581 analysis of dynamic, multifaceted control of Arc synthesis during mAchR signaling
22302811 Strong fibrinogen and Abeta deposition is demonstrated in small- and medium-sized vessels, but not in large cerebral arteries, of 24-month-old transgenic arcAbeta mice.
22036569 Arc Expression Is Increased in medial frontal cortex of patients with Alzheimer's Disease.
17120280 Arc/MS2 mRNA assembles into particles that move independently, bidirectionally, and intermittently. These observations identify several phases of Arc mRNA movement that serve as potential points for regulating Arc mRNA localization.
15103018 The mRNA expression levels for alpha-tubulin, TRADD, IFN-gamma R2, GAS1, MADD, NF-kappaB, I-kappa B, 14-3-3 protein, APaf1, PARP, IGF-1 receptor, RB1, Rb2/p130, ARC, and caspase 6 are upregulated in human neuronal cells after treatment with HIV-1 gp120

AA Sequence

MELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLAEVSKQVERELKGLHRSVGK      1 - 70
LESNLDGYVPTSDSQRWKKSIKACLCRCQETIANLERWVKREMHVWREVFYRLERWADRLESTGGKYPVG     71 - 140
SESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVD    141 - 210
TQIFEDPREFLSHLEEYLRQVGGSEEYWLSQIQNHMNGPAKKWWEFKQGSVKNWVEFKKEFLQYSEGTLS    211 - 280
REAIQRELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRFLRHPLPKTLEQLIQ    281 - 350
RGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSESVASDRTQPE                            351 - 396
//

Text Mined References (21)

PMID Year Title
26995091 2016 Decreased apoptosis repressor with caspase recruitment domain confers resistance to sunitinib in renal cell carcinoma through alternate angiogenesis pathways.
26516611 2015 Common variants in the ARC gene are not associated with cognitive abilities.
26474411 2015 Association of SNPs in EGR3 and ARC with Schizophrenia Supports a Biological Pathway for Schizophrenia Risk.
26380114 2015 New Insights on Retrieval-Induced and Ongoing Memory Consolidation: Lessons from Arc.
26038830 2015 Altered Markers of Cortical ?-Aminobutyric Acid Neuronal Activity in Schizophrenia: Role of the NARP Gene.
25748042 2015 Arc is a flexible modular protein capable of reversible self-oligomerization.
25344068 2014 Constant rate of p53 tetramerization in response to DNA damage controls the p53 response.
24945773 2014 Triad3A regulates synaptic strength by ubiquitination of Arc.
22622366 2012 A novel ARC gene polymorphism is associated with reduced risk of Alzheimer's disease.
22584581 2012 Balancing Arc synthesis, mRNA decay, and proteasomal degradation: maximal protein expression triggered by rapid eye movement sleep-like bursts of muscarinic cholinergic receptor stimulation.
22302811 2012 Contrast-enhanced magnetic resonance microangiography reveals remodeling of the cerebral microvasculature in transgenic ArcA? mice.
22036569 2011 Arc/Arg3.1 regulates an endosomal pathway essential for activity-dependent ?-amyloid generation.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
17466953 2007 Activity-regulated cytoskeleton-associated protein Arc/Arg3.1 binds to spectrin and associates with nuclear promyelocytic leukemia (PML) bodies.
17120280 2007 Dynamics of bidirectional transport of Arc mRNA in neuronal dendrites.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11117363 2000 Human activity-regulated cytoskeleton-associated gene (ARC) maps to chromosome 8q24.
10970730 2000 Mutation screening of the chromosome 8q24.3-human activity-regulated cytoskeleton-associated gene (ARC) in idiopathic generalized epilepsy.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.