Property Summary

NCBI Gene PubMed Count 16
PubMed Score 39.03
PubTator Score 6.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
interstitial lung disease -1.200 4.6e-02
malignant mesothelioma -1.900 1.2e-07
osteosarcoma -3.216 2.5e-04
medulloblastoma -4.200 1.6e-12
cystic fibrosis 1.522 1.1e-05
atypical teratoid / rhabdoid tumor -3.200 4.2e-05
glioblastoma -1.700 4.8e-03
medulloblastoma, large-cell -4.500 5.8e-08
primitive neuroectodermal tumor -2.500 8.4e-03
non-small cell lung cancer -1.537 1.7e-15
intraductal papillary-mucinous adenoma (... 1.500 1.5e-02
lung cancer -2.300 3.5e-06
pediatric high grade glioma -1.300 3.6e-03
primary Sjogren syndrome 1.200 1.2e-03
lung adenocarcinoma -1.500 1.0e-12
lung carcinoma -3.800 2.0e-45
spina bifida -1.545 4.2e-02
progressive supranuclear palsy -1.200 1.4e-02
ovarian cancer -2.300 6.1e-07
pituitary cancer -1.200 3.9e-03
facioscapulohumeral dystrophy 2.100 2.5e-02

Gene RIF (4)

PMID Text
25225293 ACAP1 and ARAP2 each colocalize with Arf6 but they did not colocalize with each other and have opposing effects on focal adhesions.
23295182 ARAP2 signals through Arf6 and Rac1 to control focal adhesion morphology
20823205 Our findings indicate that ARAP2 promotes InlB-mediated entry of Listeria monocytogenes in part, by antagonizing the host GTPase Arf6.
17077126 ARAP2 is an Arf6GAP that functions downstream of RhoA to regulate focal adhesion dynamics.

AA Sequence

MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRILKQLQIILSK      1 - 70
MQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQLETVRKNLEDSDASVERSQYP     71 - 140
QSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIESLITKKTVDHTVEEQQTEKVKLITENLSKLP    141 - 210
NADSECLSFVGCSTSGTNSGNGTNGLLEGSPPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSR    211 - 280
SFLLRHRPVPEIPGSTKGVSGSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRS    281 - 350
IKNEFLTQGEALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE    351 - 420
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASAKKVKSGWLD    421 - 490
KLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEE    491 - 560
ERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYKAKIFTVLSGNSVWLCKNEQDFKSGLGITII    561 - 630
PMNVANVKQVDRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSC    631 - 700
ADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGN    701 - 770
LQKDEELHMDSPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC    771 - 840
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQAPSAASKLS    841 - 910
SEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKEDFYLNTGPIFIFEIYLPSERV    911 - 980
FLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKGWFAMDKSSLHFCLQM    981 - 1050
QEVQGDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQD   1051 - 1120
QQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLK   1121 - 1190
SFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN   1191 - 1260
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLI   1261 - 1330
EVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERPLHYKENVLEQVL   1331 - 1400
RWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGILKIKEEPSKILSGNKFQDRYFVLRDGFLFL   1401 - 1470
YKDVKSSKHDKMFSLSSMKFYRGVKKKMKPPTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYD   1471 - 1540
IWPPAGKERKRSITKNPKIGGLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERAS   1541 - 1610
MVAHCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI   1611 - 1680
EELNVVLQRSRTLPKELQDEQILK                                                 1681 - 1704
//

Text Mined References (16)

PMID Year Title
25225293 2014 The Arf6 GTPase-activating proteins ARAP2 and ACAP1 define distinct endosomal compartments that regulate integrin ?5?1 traffic.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23295182 2013 ARAP2 signals through Arf6 and Rac1 to control focal adhesion morphology.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
20823205 2010 Critical role for the host GTPase-activating protein ARAP2 in InlB-mediated entry of Listeria monocytogenes.
18615156 Genome-wide association scan identifies candidate polymorphisms associated with differential response to anti-TNF treatment in rheumatoid arthritis.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17077126 2006 ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11804590 2002 ARAP1: a point of convergence for Arf and Rho signaling.
11804589 2002 Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.
9847074 1998 Toward a complete human genome sequence.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.