Property Summary

NCBI Gene PubMed Count 28
PubMed Score 13.58
PubTator Score 10.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
ovarian cancer 8491 1.0e-06
psoriasis 6685 1.1e-04
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Type 2 diabetes mellitus 192 0.0 2.0
Disease Target Count Z-score Confidence
Kidney hypertrophy 4 3.1 1.6
Disease Target Count
Sickle Cell Anemia 54

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 2.000 1.1e-04
ovarian cancer 1.600 1.0e-06

 IMPC Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (13)

PMID Text
25749274 Genetic variant rs1552224 of CENTD2 on chromosome 11 contributes to an independent effect as well as joint cumulative effect with rs2237897 of KCNQ1 on the risk of type 2 diabetes mellitus in Chinese Han population.
24439111 The proinsulin-decreasing and T2D-risk Alleles are associated with increased ARAP1 mRNA levels in primary human pancreatic islets.
22573888 a novel molecular mechanism of circular dorsal ruffles ring size control through the ARAP1-Arf1/5 pathway.
22357923 Arap1 is highly expressed in the renal vasculature, and its expression is suppressed by angiotensin II.
21275903 ARAP1 associated with CIN85 affects epidermal growth factor receptor endocytic trafficking
21267535 Of the lead variants from 12 novel type 2 diabetes associated loci, CENTD2 significantly associated with increased plasma glucose values and decreased glucose-stimulated insulin release.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20554524 PTK6 enhances EGFR signaling by inhibition of EGFR down-regulation through phosphorylation of ARAP1 in breast cancer cells.
19666464 Data suggest that ARAP1 is recruited to membranes independently of PtdIns(3,4,5)P(3), the subsequent production of which triggers enzymatic activity.
18939958 ARAP1 regulates the endocytic traffic of EGFR and, consequently, the rate of EGFR signal attenuation
18764928 ARAP1 controls the late steps of the endocytic trafficking of the EGF-R
18165900 ARAP1 knockdown significantly compromises the localization of death receptor 4 at the cell surface of several tumor cell lines and slows down their TRAIL-induced death.
18003747 ARAP1 acts primarily on Arf6 in vivo.

AA Sequence

MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRILAGLLRAHTS      1 - 70
PAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPRRSCLPPTCFTTPSTAAPDPV     71 - 140
LPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLLPSLSSPPQPQSEEPLSTLPQGPPQPPSPPP    141 - 210
CPPEIPPKPVRLFPEFDDSDYDEVPEEGPGAPARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGD    211 - 280
EEEDDHAYEGVPNGGWHTSSLSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWV    281 - 350
RLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE    351 - 420
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGITFIDMSVGNV    421 - 490
KEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAERIWAAAPNRFCADCGAPQPDW    491 - 560
ASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTETLIELFLQLGNGAGNRFWAANVPPSEALQPS    561 - 630
SSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTP    631 - 700
LALAEQAGQTLQMEFLRNNRTTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFS    701 - 770
RRWCVLGDGVLSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE    771 - 840
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQ    841 - 910
ELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTLSEQQLGDSDIPVIVYRCVDY    911 - 980
ITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLRDLPDGLFTRAQRLT    981 - 1050
WLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQ   1051 - 1120
DYKAGRVVEDLINHYVVVFSVDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQH   1121 - 1190
IKVPASMTAEELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ   1191 - 1260
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQRPWSGAPETS   1261 - 1330
HRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFATFLFVQHDGLV   1331 - 1400
WPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFTADPLSLLRNV                       1401 - 1450
//

Text Mined References (35)

PMID Year Title
25749274 2015 Joint effect of CENTD2 and KCNQ1 polymorphisms on the risk of type 2 diabetes mellitus among Chinese Han population.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24439111 2014 A common functional regulatory variant at a type 2 diabetes locus upregulates ARAP1 expression in the pancreatic beta cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22573888 2012 ARAP1 regulates the ring size of circular dorsal ruffles through Arf1 and Arf5.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
22357923 2012 Angiotensin AT1 receptor-associated protein Arap1 in the kidney vasculature is suppressed by angiotensin II.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21275903 2011 ARAP1 association with CIN85 affects epidermal growth factor receptor endocytic trafficking.
21269460 2011 Initial characterization of the human central proteome.
21267535 2011 Type 2 diabetes risk allele near CENTD2 is associated with decreased glucose-stimulated insulin release.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20554524 2010 PTK6 inhibits down-regulation of EGF receptor through phosphorylation of ARAP1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19666464 2009 A PH domain in the Arf GTPase-activating protein (GAP) ARAP1 binds phosphatidylinositol 3,4,5-trisphosphate and regulates Arf GAP activity independently of recruitment to the plasma membranes.
18939958 2008 ARAP1 regulates endocytosis of EGFR.
18764928 2008 ARAP1 regulates EGF receptor trafficking and signalling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18165900 2008 Arf and Rho GAP adapter protein ARAP1 participates in the mobilization of TRAIL-R1/DR4 to the plasma membrane.
18003747 2008 Substrate specificities and activities of AZAP family Arf GAPs in vivo.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11804590 2002 ARAP1: a point of convergence for Arf and Rho signaling.
11804589 2002 Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.