Property Summary

NCBI Gene PubMed Count 60
PubMed Score 268.16
PubTator Score 103.85

Knowledge Summary

Patent (15,436)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 2.9e-05
glioblastoma 1.500 1.2e-06
pediatric high grade glioma 1.100 6.1e-06
pilocytic astrocytoma 1.200 2.5e-07

 GO Component (1)

Protein-protein Interaction (12)

Gene RIF (18)

PMID Text
26508523 This review discusses the regulation of A-Raf protein expression, and the roles of A-Raf in apoptosis and cancer, with a special focus on its role in resistance to Raf inhibitors. [review]
25674762 Aberrant expression of A-, B-, and C-RAF, and COT is frequent in PTC; increased expression of COT is correlated with recurrence of PTC.
25608663 analysis of FGFR2-PPHLN1 fusion and ARAF mutations in intrahepatic cholangiocarcinoma
25097033 Dimerization of the kinase ARAF promotes MAPK pathway activation and cell migration.
24652991 The study identifies somatic activating ARAF mutations in Langerhans cell histiocytosis.
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with ARAF
24114843 Galpha12-ARAF-ERK pathway stimulates RFFL transcription through the transcription factor c-Myc.
23591895 show that Araf antagonizes mesendoderm induction and patterning activity of Nodal/Smad2 signals in vertebrate embryos by directly inhibiting Smad2 signalling
23352452 Ras pathway activation via EGF treatment induced strong binding between B-Raf and C-Raf and a low level of binding between B-Raf and A-Raf.
22926515 study investigated role of ARAF in cancer cell signaling and examined the role of ARAF in mediating paradoxical activation of the MAPK pathway in cells treated with RAF inhibitors; ARAF seems to stabilize BRAF:CRAF complexes in cells treated with RAF inhibitors and regulate cell signaling in a subtle manner to ensure signaling efficiency
20145135 hnRNP H blocks MST2-mediated apoptosis in cancer cells by regulating A-Raf transcription.
18662992 Positive regulation of A-RAF by phosphorylation of isoform-specific hinge segment and identification of novel phosphorylation sites.
16980614 These data reveal that B-RAF is an important mediator of neuronal survival, migration, and dendrite formation and that A-RAF cannot fully compensate for these functions.
15736953 A-Raf residues are identified that bind to specific phosphoinositides, possibly as a mechanism to localize the enzyme to particular membrane microdomains rich in these phospholipids.
14688025 mutation analysis of the conserved regions in the ARAF gene in human colorectal adenocarcinoma
14684750 A-Raf kinase is negatively regulated by trihydrophobin 1
11952167 In a two-hybrid screen of human fetal liver cDNA library, TH1 was detected as a new interaction partner of A-Raf; this specific interaction may have played a critical role in the activation of A-Raf.
8621729 A-Raf interacts with MEK1 and activates MEK1 by phosphorylation.

AA Sequence

MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKT      1 - 70
VTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKV     71 - 140
PTVCVDMSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRI    141 - 210
RSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRE    211 - 280
RKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVSQPTAEQAQA    281 - 350
FKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYL    351 - 420
HAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQS    421 - 490
DVYAYGVVLYELMTGSLPYSHIGCRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLF    491 - 560
PQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAARLVP                            561 - 606
//

Text Mined References (70)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26508523 2015 A-Raf: A new star of the family of raf kinases.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25674762 2015 Aberrant expression of COT is related to recurrence of papillary thyroid cancer.
25608663 2015 Massive parallel sequencing uncovers actionable FGFR2-PPHLN1 fusion and ARAF mutations in intrahepatic cholangiocarcinoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25097033 2014 Dimerization of the kinase ARAF promotes MAPK pathway activation and cell migration.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24746704 2014 Disruption of CRAF-mediated MEK activation is required for effective MEK inhibition in KRAS mutant tumors.
24652991 2014 Somatic activating ARAF mutations in Langerhans cell histiocytosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24114843 2013 Different Raf protein kinases mediate different signaling pathways to stimulate E3 ligase RFFL gene expression in cell migration regulation.
23591895 2013 Araf kinase antagonizes Nodal-Smad2 activity in mesendoderm development by directly phosphorylating the Smad2 linker region.
23352452 2013 Effects of Raf dimerization and its inhibition on normal and disease-associated Raf signaling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22926515 2013 ARAF acts as a scaffold to stabilize BRAF:CRAF heterodimers.
22609986 2012 PRR5L degradation promotes mTORC2-mediated PKC-? phosphorylation and cell migration downstream of G?12.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20936779 2010 A human MAP kinase interactome.
20145135 2010 Heterogeneous nuclear ribonucleoprotein H blocks MST2-mediated apoptosis in cancer cells by regulating A-Raf transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20052757 2010 Molecular and clinical analysis of RAF1 in Noonan syndrome and related disorders: dephosphorylation of serine 259 as the essential mechanism for mutant activation.
19933840 2010 Regulation of IRSp53-dependent filopodial dynamics by antagonism between 14-3-3 binding and SH3-mediated localization.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667065 2009 Identification of novel in vivo phosphorylation sites of the human proapoptotic protein BAD: pore-forming activity of BAD is regulated by phosphorylation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18662992 2008 Positive regulation of A-RAF by phosphorylation of isoform-specific hinge segment and identification of novel phosphorylation sites.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17979178 2007 A novel tandem affinity purification strategy for the efficient isolation and characterisation of native protein complexes.
17603482 2007 Germline gain-of-function mutations in RAF1 cause Noonan syndrome.
17535970 2007 DA-Raf1, a competent intrinsic dominant-negative antagonist of the Ras-ERK pathway, is required for myogenic differentiation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16980614 2006 Cortical migration defects in mice expressing A-RAF from the B-RAF locus.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15778465 2005 Targeted proteomic analysis of 14-3-3 sigma, a p53 effector commonly silenced in cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15763428 2005 A-Raf associates with and regulates platelet-derived growth factor receptor signalling.
15736953 2005 Identification of key residues in the A-Raf kinase important for phosphoinositide lipid binding specificity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14688025 2004 Mutation analysis of the BRAF, ARAF and RAF-1 genes in human colorectal adenocarcinomas.
14684750 2004 Trihydrophobin 1 is a new negative regulator of A-Raf kinase.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11952167 2002 Identification of TH1 as an interaction partner of A-Raf kinase.
11909642 2002 Identification of interaction between MEK2 and A-Raf-1.
11812000 2002 Two phosphorylation-independent sites on the p85 SH2 domains bind A-Raf kinase.
10967104 2000 Using a phage display library to identify basic residues in A-Raf required to mediate binding to the Src homology 2 domains of the p85 subunit of phosphatidylinositol 3'-kinase.
10848612 2000 Isoform-specific localization of A-RAF in mitochondria.
9110174 1997 Large-scale concatenation cDNA sequencing.
9042965 1997 A-Raf kinase is a new interacting partner of protein kinase CK2 beta subunit.
8621729 1996 Selective activation of MEK1 but not MEK2 by A-Raf from epidermal growth factor-stimulated Hela cells.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8394352 1993 Activation of mitogen-activated protein kinase/extracellular signal-regulated kinase kinase by G protein and tyrosine kinase oncoproteins.
8157000 1994 Identification of the sites in MAP kinase kinase-1 phosphorylated by p74raf-1.
8020955 1994 The complete sequence and promoter activity of the human A-raf-1 gene (ARAF1).
7731720 1995 B-Raf protein isoforms interact with and phosphorylate Mek-1 on serine residues 218 and 222.
3529082 1986 Pks, a raf-related sequence in humans.
3029685 1987 The complete coding sequence of the human A-raf-1 oncogene and transforming activity of a human A-raf carrying retrovirus.
2717185 1989 Localization of the pKs gene, a raf related sequence on human chromosomes X and 7.
1262038 1976 A flexible renewal process simulator for neural spike trains.