Property Summary

Ligand Count 803
NCBI Gene PubMed Count 1,968
PubMed Score 7137.71
PubTator Score 7221.94

Knowledge Summary

Patent (193,439)

TINX Plot

  Disease (10)

Disease Target Count
Male infertility 206
Gynecomastia 64
Cryptorchidism 296
Hypogonadism 173
Infertility 188
Abnormality of the rib cage 12
Absent axillary hair 5
Absent facial hair 2
Absent or rudimentary fallopian tubes 2
Absent pubic hair 2
Adult onset 82
Alcohol withdrawal syndrome 20
Alcoholic Intoxication, Chronic 289
Aplasia/Hypoplasia of the fallopian tube 2
Atrophy of testis 14
Atrophy, Muscular, Spinobulbar 1
Azoospermia 110
Bifid scrotum 16
Bulbar palsy 19
Bulbar weakness 19
Bulbo-Spinal Atrophy, X-Linked 1
Bulbospinal Neuronopathy 1
Calf muscle hypertrophy 9
Congenital absence of vas deferens 3
Congenital hypoplasia of penis 176
Craving for alcohol 3
Creatine phosphokinase serum increased 110
Decreased fertility 33
Decreased tendon reflex 122
Deglutition Disorders 132
Depressive disorder 409
Dysarthria 192
Dysphonia 7
Elevated creatine kinase 110
Elevated follicle stimulating hormone 15
Elevated luteinizing hormone 14
Erectile abnormalities 16
Female Pseudohermaphroditism 5
Female external genitalia in males 13
Female infertility 30
Gait abnormality 135
Gestational diabetes 26
Gonadal neoplasm 1
Hernia, Inguinal 89
Hypertensive disease 292
Hypospadias, perineal 5
Liver carcinoma 240
Male Pseudohermaphroditism 19
Mammary Neoplasms 425
Mental Depression 333
Mood Disorders 184
Mouth Abnormalities 14
Muscle Cramp 55
Muscle hypotonia 571
Muscle weakness of limb 21
Muscular fasciculation 22
Nephrolithiasis 56
Neurogenic Muscular Atrophy 139
Neurogenic muscle atrophy, especially in the lower limbs 139
Neuropathy 261
Osteoporosis 363
Penile hypospadias 106
Peripheral Neuropathy 134
Primary physiologic amenorrhea 55
Prostatic Intraepithelial Neoplasias 11
Reifenstein Syndrome 1
Schizophrenia 1160
Sensory neuropathy 20
Skeletal muscle atrophy 139
Slow progression 89
Sparse axillary hair 28
Sparse pubic hair 31
Tremor 113
Uterus absent (finding) 4
X- linked recessive 110
abnormal growth 26
muscle degeneration 139
Disease Target Count Z-score Confidence
DOID:9917 31 0.0 0.5
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Prostate cancer 175 8.134 4.0
Alopecia universalis 16 0.0 3.0
Disease Target Count Z-score Confidence
Pseudohermaphroditism 16 4.111 2.1
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer -2.200 4.2e-03
astrocytic glioma 1.600 2.9e-03
Atopic dermatitis -1.100 1.2e-03
atypical teratoid / rhabdoid tumor -1.600 4.3e-05
cutaneous lupus erythematosus -1.300 7.5e-03
ependymoma 1.400 1.2e-02
glioblastoma 1.200 4.8e-03
group 3 medulloblastoma -1.700 2.9e-03
interstitial cystitis -1.600 2.8e-03
intraductal papillary-mucinous adenoma (... -1.400 2.0e-03
intraductal papillary-mucinous carcinoma... -1.700 4.2e-04
intraductal papillary-mucinous neoplasm ... -1.800 3.7e-03
malignant mesothelioma 2.700 3.8e-08
medulloblastoma, large-cell -1.700 2.0e-03
osteosarcoma 1.225 1.0e-02
pancreatic ductal adenocarcinoma liver m... -2.325 5.3e-03
pituitary cancer 1.300 2.9e-02
primitive neuroectodermal tumor -1.700 1.1e-03
psoriasis -1.400 1.4e-16

 GWAS Trait (1)

PDB (81)

Gene RIF (1787)

AA Sequence

MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQ      1 - 70
QQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVA     71 - 140
ASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGR    141 - 210
AREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVR    211 - 280
PTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKS    281 - 350
GALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA    351 - 420
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGL    421 - 490
AGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTC    491 - 560
LICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGAR    561 - 630
KLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAA    631 - 700
LLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLV    701 - 770
FNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD    771 - 840
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSG    841 - 910
KVKPIYFHTQ                                                                911 - 920
//

Text Mined References (1993)

PMID Year Title