Property Summary

NCBI Gene PubMed Count 84
PubMed Score 155.02
PubTator Score 124.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Atopic dermatitis -1.900 1.5e-07
group 3 medulloblastoma -1.100 1.8e-02
interstitial cystitis 2.200 1.2e-03
invasive ductal carcinoma 1.340 1.4e-02
lung adenocarcinoma -1.100 3.1e-04
lung cancer -1.800 2.1e-04
lung carcinoma -3.500 4.1e-23
mucosa-associated lymphoid tissue lympho... 2.475 8.9e-03
non-small cell lung cancer -1.717 1.3e-13
oligodendroglioma -1.100 2.8e-03
ovarian cancer -4.900 2.8e-16
pancreatic cancer 1.200 5.6e-03
pancreatic carcinoma 1.200 5.6e-03
pancreatic ductal adenocarcinoma liver m... -1.955 2.4e-02
psoriasis -1.300 4.4e-04
tuberculosis -2.100 9.7e-05
ulcerative colitis 2.600 4.3e-04

Synonym

Accession O43315 Q9NP32 AQP-9
Symbols SSC1
AQP-9
T17287
HsT17287

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (53)

AA Sequence

MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAM      1 - 70
AIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVG     71 - 140
ENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLN    141 - 210
SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTE    211 - 280
QSEDKPEKYELSVIM                                                           281 - 295
//

Text Mined References (85)

PMID Year Title