Property Summary

NCBI Gene PubMed Count 55
PubMed Score 112.27
PubTator Score 72.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
26779650 AQP6 and AQP8 had different expression degrees in epithelial ovarian tissues, which suggests that AQP6 and AQP8 may play certain roles in epithelial ovarian tumors.
25550802 EGF induces AQP8 expression and cell migration in Eca-109 cells via the EGFR/Erk1/2 signal transduction pathway.
25120769 increased AQP8, Erk1/2 and phosphorylated-Erk1/2 expression may play a role in transformation of cervical intraepithelila neoplasia into cervical cancer, and in early invasion and lymphatic metastasis of cervical cancer
24440277 the results here reported indicate that AQP8 is able to modulate H2O2 transport through the plasma membrane affecting redox signalling linked to leukaemia cell proliferation
24415197 mtAQP8 knockdown induces necrotic cell death in human neoplastic hepatic cells, a finding that might be relevant to therapeutic strategies against hepatoma cells.
24055034 The expression levels and immunoreactive score of AQP8 protein and mRNA increased in low-grade astrocytomas, and further increased in high-grade astrocytomas, especially in glioblastoma.
23953589 AQP8 has a role in the pathogenesis of PCOS.
23679281 High Aquaporin 8 expression is associated with invasion of cervical cancer.
23595390 AQP8 and its relationship with miRNAs may be involved in the pathogenesis of Ulcerative colitis (UC).
22901156 AQP8 expression significantly increased in advanced stage of cervical cancer, deeper infiltration, metastatic lymph nodes and larger tumor volume.
22192778 Reconstitution of water channel function and 2D-crystallization of human aquaporin 8.
20732771 When polyhydramnios occurs, expression of aquaporin 8 and aquaporin 9 in fetal membranes and placenta is an adaptive change.
20424473 Observational study of gene-disease association. (HuGE Navigator)
20144166 Aquaporin 8 has a role in intramembranous water transport and the balance of amniotic fluid.
19563057 The expression of AQP8 mRNA and protein is significantly increased in the amnion and placenta of polyhydramnios, suggesting that AQP8 may play an important role in the regulation of amniotic fluid volume.
19087520 With the increase of cAMP, AQP8 mRNA and protein expressions significantly increased in WISH cells in vitro.
18948439 Knockdown of hepatocyte aquaporin-8 by RNA interference induces defective bile canalicular water transport.
18788571 The expression of AQP8 protein is positively correlated with bcl-2 protein in human cervical carcinoma.
17545093 Data show that AQP-1, 3, 8, 9 mRNA expression was detected in both amnion and chorion and can be associated with intramembranous transport and volume regulation of amniotic fluid.
17461471 Upregulation of AQP8 in the colon of ulcerative colitis patients represents a secondary phenomenon which may disturb the physiologic colonic mucus barrier and thus lead to chronic inflammation and ulceration.
12712100 expression of aquaporin 8 water channel in and up-regulation by second messenger cyclic adenosine monophosphate. Aquaporin 8 messenger RNA has relatively short biologic half-life in vitro.
11231887 Aquaporin 8 is expressed in colonic epithelial cells but was not detected in colorectal tumors.
9325099 The crystal structure of deoxyhemoglobin S, 2HBS, demonstrates the interaction of the mutant valine with another hemoglobin tetramer and provides insights into formation of the intracellular sickle cell fiber.

AA Sequence

MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPAL      1 - 70
AHGLALGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNA     71 - 140
SGAAFVTVQEQGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMN    141 - 210
PARAFGPAVVANHWNFHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR                       211 - 261
//

Text Mined References (56)

PMID Year Title
26779650 2016 Expression of AQP6 and AQP8 in epithelial ovarian tumor.
25550802 2014 Aquaporin-8 mediates human esophageal cancer Eca-109 cell migration via the EGFR-Erk1/2 pathway.
25120769 2014 Expression of aquaporin 8 and phosphorylation of Erk1/2 in cervical epithelial carcinogenesis: correlation with clinicopathological parameters.
24440277 2014 Specific aquaporins facilitate Nox-produced hydrogen peroxide transport through plasma membrane in leukaemia cells.
24415197 2014 Evidence for necrosis, but not apoptosis, in human hepatoma cells with knockdown of mitochondrial aquaporin-8.
24055034 2013 Expression of aquaporin8 in human astrocytomas: correlation with pathologic grade.
23953589 2013 Association of AQP8 in women with PCOS.
23679281 2013 Increased migration and local invasion potential of SiHa cervical cancer cells expressing Aquaporin 8.
23595390 2013 Aquaporin 8 expression is reduced and regulated by microRNAs in patients with ulcerative colitis.
22901156 2012 Significance and expression of aquaporin 1, 3, 8 in cervical carcinoma in Xinjiang Uygur women of China.
22192778 2012 Reconstitution of water channel function and 2D-crystallization of human aquaporin 8.
21251984 2011 Water permeability and characterization of aquaporin-11.
20732771 2010 The expression of aquaporin 8 and aquaporin 9 in fetal membranes and placenta in term pregnancies complicated by idiopathic polyhydramnios.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20144166 2009 Expression of aquaporin 8 is diversely regulated by osmotic stress in amnion epithelial cells.
19563057 2009 [Expression of aquaporin 8 in human fetal membrane and placenta of idiopathic polyhydramnios].
19087520 2008 [Relationship between cyclic adenosine monophosphate and aquaporin 8 expression and distribution in human amnion-derived cells].
18948439 2009 Knockdown of hepatocyte aquaporin-8 by RNA interference induces defective bile canalicular water transport.
18788571 2008 [Expression of aquaporin-8 and bcl-2 protein in human cervical carcinoma and their correlations].
18762715 2008 Functional characterization of human aquaporin 9 as a facilitative glycerol carrier.
18511455 2008 Novel variants in human Aquaporin-4 reduce cellular water permeability.
18501347 2008 Functional characterization of a human aquaporin 0 mutation that leads to a congenital dominant lens cataract.
18202181 2008 Mechanism of selectivity in aquaporins and aquaglyceroporins.
17636236 2007 Cyclic adenosine monophosphate regulation of aquaporin gene expression in human amnion epithelia.
17545093 2007 [Expression of aquaporins 1, 3, 8, 9 mRNA in human fetal membranes].
17461471 2007 Aquaporin-8 expression is reduced in ileum and induced in colon of patients with ulcerative colitis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178220 2007 Identification of arylsulfonamides as Aquaporin 4 inhibitors.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16596446 2005 Roles of aquaporin-3 water channels in volume-regulatory water flow in a human epithelial cell line.
15948717 2006 Purification and functional characterization of aquaporin-8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14701836 2004 Aquaporin-1, nothing but a water channel.
12801959 2003 Distribution of aquaporin water channels AQP1 and AQP5 in the ductal system of the human pancreas.
12712100 2003 Expression of aquaporin 8 and its up-regulation by cyclic adenosine monophosphate in human WISH cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084581 2002 Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin.
11717661 2001 Expression of aquaporin-8 in human placenta and chorioamniotic membranes: evidence of molecular mechanism for intramembranous amniotic fluid resorption.
11573934 2001 Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11231887 2001 Differential expression of aquaporin 8 in human colonic epithelial cells and colorectal tumors.
11076974 2000 The subcellular localization of an aquaporin-2 tetramer depends on the stoichiometry of phosphorylated and nonphosphorylated monomers.
11034202 2000 Structural determinants of water permeation through aquaporin-1.
11001937 2000 Functional impairment of lens aquaporin in two families with dominantly inherited cataracts.
10564231 1999 Functional and molecular characterization of the human neutral solute channel aquaporin-9.
10510269 1999 Functional characterization and localization of AQP3 in the human colon.
10393433 1999 Assignment of the aquaporin-8 water channel gene (AQP8) to human chromosome 16p12.
9829975 1998 Bidirectional water fluxes and specificity for small hydrophilic molecules in aquaporins 0-5.
9806845 1998 Cloning and functional expression of human aquaporin8 cDNA and analysis of its gene.
9405233 1997 Molecular cloning and expression of a novel human aquaporin from adipose tissue with glycerol permeability.
9369468 1997 Mercury-sensitive residues and pore site in AQP3 water channel.
9325099 1997 The high resolution crystal structure of deoxyhemoglobin S.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7530250 1995 Molecular cloning and characterization of an aquaporin cDNA from salivary, lacrimal, and respiratory tissues.
1510932 1992 Reconstitution of functional water channels in liposomes containing purified red cell CHIP28 protein.
1373524 1992 Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.