Property Summary

NCBI Gene PubMed Count 51
PubMed Score 153.64
PubTator Score 61.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 2.2e-19

Protein-protein Interaction (1)

Gene RIF (20)

PMID Text
26313002 the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells.
24463099 REVIEW: the current knowledge on the role of the glycerol channels AQP7 and AQP9 in controlling glycerol metabolism in adipose tissue and liver
24376702 a direct involvement of AQP7 in water and glycerol transport
24334538 AQP7-specific glycerol transport was furthermore found to be specifically inhibited.
23290745 AQP7 is expressed in human and mouse oocytes and upregulated by cryoprotectants.
23235401 AQP7 overexpression may be related to insulin sensitivity and glucose homeostasis in women with the polycystic ovary syndrome.
23001483 AQP7 is regulated in response to physical training in a gender-dependent manner in adipose tissue.
22899094 The discovery of an association between urine glycerol loss and a platelet secretion defect is a novel one, and our findings imply the involvement of AQPs in platelet secretion.
22425521 There is a coordinated regulation of adipose AQP7 and hepatic AQP9 gene expression that is distorted in metabolic syndrome X.
22206455 In all of the 33 investigated semen samples, we observed AQP7 binding to the sperm sur-face with different intensity and modality.
21609198 Diazoxide may have an impact on myocardial water balance and glycerol energy supply by decreasing relative aquaporin-7 expression during coronary artery bypass grafting.
20463097 these data suggest a subtle regulation between adipose depots of the sole adipose aquaporin, AQP7, which is unbalanced in obesity and T2D.
19615702 we found a greater expression found in visceral fat, and between subcutaneous adipose AQP7 and hepatic aquaporin 9 gene expression within the context of human morbid obesity
18401671 increased gene expression in visceral adipose tissue and liver in morbid obesity
17566090 Expression of AQP7 is down-regulated in women with severe obesity. The expression of this glycerol channel is not affected by type 2 diabetes.
17562358 Dysfunction of AQP7 in the periadventitial fat may trigger the inflammation involved in aatherosclerosis.
17351148 Observational study of gene-disease association. (HuGE Navigator)
17351148 AQP7 downregulation is pathogenic for obesity and/or type 2 diabetes.
16325777 In summary, our data show that the AQP7 gene is differentially expressed in adipose tissue of lean and obese individuals.
11952783 determination of genomic structure, promotor analysis and functional mutation

AA Sequence

MVQASGHRRSTRGSKMVSWSVIAKIQEILQRKMVREFLAEFMSTYVMMVFGLGSVAHMVLNKKYGSYLGV      1 - 70
NLGFGFGVTMGVHVAGRISGAHMNAAVTFANCALGRVPWRKFPVYVLGQFLGSFLAAATIYSLFYTAILH     71 - 140
FSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLTGMLQLCLFAITDQENNPALPGTEALVIGILV    141 - 210
VIIGVSLGMNTGYAINPSRDLPPRIFTFIAGWGKQVFSNGENWWWVPVVAPLLGAYLGGIIYLVFIGSTI    211 - 280
PREPLKLEDSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMALEHF            281 - 342
//

Text Mined References (52)

PMID Year Title
26313002 2015 Aquaporins Mediate Silicon Transport in Humans.
24463099 2014 Metabolic impact of the glycerol channels AQP7 and AQP9 in adipose tissue and liver.
24376702 2013 Biophysical assessment of human aquaporin-7 as a water and glycerol channel in 3T3-L1 adipocytes.
24334538 2014 Functional characteristics of aquaporin 7 as a facilitative glycerol carrier.
23290745 2013 Cryoprotectants up-regulate expression of mouse oocyte AQP7, which facilitates water diffusion during cryopreservation.
23235401 2013 Aquaglyceroporin-7 overexpression in women with the polycystic ovary syndrome.
23001483 2012 Gender-specific effect of physical training on AQP7 protein expression in human adipose tissue.
22899094 2013 Homozygosity for aquaporin 7 G264V in three unrelated children with hyperglyceroluria and a mild platelet secretion defect.
22425521 Implications of aquaglyceroporins 7 and 9 in glycerol metabolism and metabolic syndrome.
22206455 2012 Immunolocalization of aquaporin 7 in human sperm and its relationship with semen parameters.
21609198 2011 Aquaporin-7 expression during coronary artery bypass grafting with diazoxide.
21251984 2011 Water permeability and characterization of aquaporin-11.
20463097 2010 Paired subcutaneous and visceral adipose tissue aquaporin-7 expression in human obesity and type 2 diabetes: differences and similarities between depots.
19615702 2009 Gene expression of paired abdominal adipose AQP7 and liver AQP9 in patients with morbid obesity: relationship with glucose abnormalities.
18762715 2008 Functional characterization of human aquaporin 9 as a facilitative glycerol carrier.
18718702 2009 Expression and localisation of aquaporin water channels in human urothelium in situ and in vitro.
18511455 2008 Novel variants in human Aquaporin-4 reduce cellular water permeability.
18501347 2008 Functional characterization of a human aquaporin 0 mutation that leads to a congenital dominant lens cataract.
18401671 2008 Influence of morbid obesity and insulin resistance on gene expression levels of AQP7 in visceral adipose tissue and AQP9 in liver.
18202181 2008 Mechanism of selectivity in aquaporins and aquaglyceroporins.
17566090 2007 Adipose tissue expression of the glycerol channel aquaporin-7 gene is altered in severe obesity but not in type 2 diabetes.
17562358 2008 Dysfunction of AQP7 in the periadventitial fat: A novel trigger of atherosclerosis.
17351148 2007 A functional variant of the adipocyte glycerol channel aquaporin 7 gene is associated with obesity and related metabolic abnormalities.
17178220 2007 Identification of arylsulfonamides as Aquaporin 4 inhibitors.
16596446 2005 Roles of aquaporin-3 water channels in volume-regulatory water flow in a human epithelial cell line.
16325777 2006 Differential expression of aquaporin 7 in adipose tissue of lean and obese high fat consumers.
15948717 2006 Purification and functional characterization of aquaporin-8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701836 2004 Aquaporin-1, nothing but a water channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084581 2002 Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin.
11952783 2002 Human aquaporin adipose (AQPap) gene. Genomic structure, promoter analysis and functional mutation.
11573934 2001 Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum.
11076974 2000 The subcellular localization of an aquaporin-2 tetramer depends on the stoichiometry of phosphorylated and nonphosphorylated monomers.
11034202 2000 Structural determinants of water permeation through aquaporin-1.
11001937 2000 Functional impairment of lens aquaporin in two families with dominantly inherited cataracts.
10564231 1999 Functional and molecular characterization of the human neutral solute channel aquaporin-9.
10510269 1999 Functional characterization and localization of AQP3 in the human colon.
9931374 1999 Immunohistochemical localization of a water channel, aquaporin 7 (AQP7), in the rat testis.
9829975 1998 Bidirectional water fluxes and specificity for small hydrophilic molecules in aquaporins 0-5.
9824541 1998 Aquaporins (water channels): role in vasopressin-activated water transport.
9806845 1998 Cloning and functional expression of human aquaporin8 cDNA and analysis of its gene.
9714739 1998 Molecular characterization of human Aquaporin-7 gene and its chromosomal mapping.
9405233 1997 Molecular cloning and expression of a novel human aquaporin from adipose tissue with glycerol permeability.
9369468 1997 Mercury-sensitive residues and pore site in AQP3 water channel.
9252401 1997 Cloning and functional expression of a new water channel abundantly expressed in the testis permeable to water, glycerol, and urea.
7530250 1995 Molecular cloning and characterization of an aquaporin cDNA from salivary, lacrimal, and respiratory tissues.
1510932 1992 Reconstitution of functional water channels in liposomes containing purified red cell CHIP28 protein.
1373524 1992 Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.