Property Summary

NCBI Gene PubMed Count 234
PubMed Score 1921.32
PubTator Score 1223.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0

Expression

  Differential Expression (26)

Disease log2 FC p
posterior fossa group B ependymoma 3.300 1.7e-08
oligodendroglioma 2.800 1.1e-02
permanent atrial fibrillation -1.200 1.6e-03
sonic hedgehog group medulloblastoma -5.100 1.8e-06
atypical teratoid / rhabdoid tumor -4.900 1.7e-04
glioblastoma -2.300 2.4e-02
medulloblastoma, large-cell -5.200 2.8e-04
primitive neuroectodermal tumor -2.800 4.5e-02
Duchenne muscular dystrophy -2.975 3.4e-09
limb girdle muscular dystrophy 2B -2.635 1.2e-04
autosomal dominant Emery-Dreifuss muscul... -1.901 2.2e-03
Becker muscular dystrophy -1.956 4.7e-03
acute quadriplegic myopathy -2.893 6.4e-06
non-small cell lung cancer -5.288 9.2e-23
lung cancer -7.300 7.8e-08
lung adenocarcinoma -3.400 6.2e-10
pediatric high grade glioma -1.800 7.6e-03
lung carcinoma -4.300 4.1e-31
progressive supranuclear palsy -1.900 2.0e-02
Breast cancer -1.700 2.6e-11
gastric carcinoma -5.100 2.6e-02
pituitary cancer -1.900 2.6e-02
Down syndrome 2.800 4.8e-04
chronic rhinosinusitis -1.217 2.4e-02
dermatomyositis -1.200 6.4e-03
psoriasis -2.800 2.0e-35

Gene RIF (195)

PMID Text
26786101 Based on a comparative mutagenic analysis of AQP1, AQP 3, and AQP 4, the results suggest that loop D interactions may provide a general structural framework for tetrameric assembly within the AQP family.
26638215 Administration of E1 + P1 and E1 + P2 decreased the inhibitory effect of E1 on the IL-6 levels and AQP4 protein expression
26530185 Study shows that the processing of AQP4 by antigen presenting cells in Lewis rats produces a highly encephalitogenic AQP4 epitope (AQP4268-285)
26512424 Measurements of the membrane water permeability of MDCK cells expressing human AQP4 mutants provide the first evidencethat the rate of water flow can also be controlled by small movements of single-amino acid side chains lining the water pore.
26419740 This study demonstrated that Subcellular localization of Aqp4 was compared between cortical and white matter astrocytes in postmortem specimens of patients with focal ischemic stroke versus controls.
26287441 The induction of antibodies to an AQP4 epitope in mice immunized with the TAX1BP1-derived peptide suggests that a latent HTLV-1 infection could lead to TAX1BP1 antigen presentation and the production of anti-AQP4 antibodies in human neuromyelitis optica.
26261083 The study demonstrated the abnormal expression pattern of AQP1, AQP2, AQP3, and AQP4 in the kidney tissues of patients with nephrotic syndrome, providing a basis for an improved understanding of the role of aquaporins in the pathogenesis of this disease.
26115524 the benign subependymomas aquaporins 1 and 4 are dramatically redistributed and upregulated.
26013827 Phosphorylation at serine 276 is necessary for AQP4 translocation in response to changes of tonicity.
26000774 Study identified two AQP4 genomic variants, rs11661256 and rs1058427, as significant predictors of combined intracerebral hemorrhage and perihematomal edema volume after intracerebral hemorrhage
25913278 Anti-AQP-4 antibodies correlate with active neuromyelitis optica disease activity and animal models
25839357 Data suggest that preventing neuromyelitis optica (NMO)-IgG aquaporin-4 (AQP4) binding would represent a strategy for a NMO therapy.
25792738 analysis of how aquaporin 4 extracellular domains mutations affect restricted binding patterns of pathogenic neuromyelitis optica IgG
25677878 AQP4 antibody was highly prevalent (almost 54%) in Egyptian idiopathic inflammatory demyelinating central nervous system patients
25668569 A patient with neuromyelitis optica had decreased AQP4 antibody levels with development of brain lesions.
25460197 The idea is that sudden, disorderly, and excessive neuronal discharges activates NOX2 with O(2)(-) production, leading to lipid peroxidation. The resulting generation of HNE targets AQP4, affecting water and ion balance.
25306413 This review focuses on the role of AQP4 in ischemic brain edema, and its prospect as a therapeutic target--{REVIEW}
25257965 results suggest that AQP4 is internalized and the lysosome is involved in degrading the internalized AQP4 post-intracerebral hemorrhage
25239624 A pivotal role for AQP4 transmembrane regions in epitope assembly in neuromyelitis optica.
25160125 Case Report: anti-aquaporin-4 antibody positive neuromyelitis optica spectrum disorder with hypothalamic lesions and sudden onset of sleep.
25128605 AQP4 is mainly targeted to the lipid rafts fraction of the plasma membrane and a change of subcellular localization of AQP4 by the treatment with cholesterol-lowering agents significantly reduces the cytotoxic effects of NMO-IgG
25096173 Polymorphisms in the coding region of AQP4 are unlikely to confer neuromyelitis optica susceptibility; the 3' UTR of this gene presents several polymorphic sites that may affect risk in the Chinese.
25027061 In demyelinating disease, major lesions in the three anti-contactin-associated protein 2 Ab-positive subjects were infratentorial, including one co-carrying anti-AQP4 Abs.
24999750 In conclusion, the present study provides evidence for possible involvement of genetic variations in AQP4 gene in the functional outcome, but not in initial severity or presence of intracranial hemorrhages of patients with TBI.
24888368 Our results suggest that hyperosmotic stress markedly reduces AQP4 expression possibly through a proteasome ubiquitinylation-independent pathway.
24866202 Case Report: relapsing inappropriate antidiuretic hormone secretion associated with neuromyelitis optica spectrum disorders, in an anti-aquaporin-4 antibody positive 14-year-old girl.
24733266 Demonstration of AQP4 immunoreactivity in this patient's small bowel endocrine tumor supports a paraneoplastic etiology for neuromyelitis optica spectrum disorder (NMOSD).
24727946 Variations in the AQP4 gene seem of limited significance as predisposing factors in Caucasian SIDS infants
24582793 results indicate that AQP-4 genetic variations and haplotypes might contribute to the risk factors for leukoaraiosis.
24415568 Patients with neuromyelitis optica spectrum disorders with MOG antibodies have distinct clinical features, fewer attacks, and better recovery than patients with AQP4 antibodies or patients seronegative for both antibodies.
24388217 [review] The discovery of autoantibodies to AQP-4, the most abundant water channel in the central nervous system, has led to the recognition of neuromyelitis optica as an autoimmune condition and as a disease entity in its own right.
24361961 No significant associations between AQP4 SNPs/haplotypes and development of IDD.
24356448 The expression of AQP4-Delta4 may represent a new regulatory mechanism through which the cell-surface expression and therefore the activity of AQP4 can be physiologically modulated.
24289379 Water self-diffusion and the dipolar response of the selectivity filter within human aquaporin 4 have been studied using molecular dynamics (MD) simulations in the absence and presence of pulses of external static and alternating electric fields.
24260168 Aquaporin-4 autoantibodies in Neuromyelitis Optica: AQP4 isoform-dependent sensitivity and specificity.
24252214 Report is the first to establish astrocytic water channel loss in a subset of human central pontine myelinolysis (CPM) cases and suggests AQP1 and AQP4 may be involved in the pathogenesis of CPM
24182872 Increased AQP4 expression could be an independent risk factor in neuromyelitis optica and other forms of CNS inflammation.
24029914 Case Reports: diagnosis of neuromyelitis optica spectrum disorders supported by their AQP4-seropositivity.
24014171 Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology.
23997151 Serological tests using recombinant AQP4 antigen are significantly more sensitive than tissue-based immunofluorescence for detecting AQP4-immunoglobulin G (IgG).
23973312 These results suggest that AQP4 functions as the modulator of synaptic plasticity and memory, and chronic Cef treatment rescues hippocampal memory deficit induced by AQP4 knockout.
23950863 Knockdown a water channel protein, aquaporin-4, induced glioblastoma cell apoptosis.
23928039 AQP1 and 4 gene expression levels did not differ between mesial temporal sclerosis patients and control groups
23915916 5-aminolevulinic acid fluorescing tissue showed higher AQP4 expression compared to normal brain tissue
23746426 Neuromyelitis optica is a demyelinating disease characterized by a disease-specific autoantibody designated as NMO-IgG that specifically recognizes aquaporin-4, and the binding of NMO-IgG to AQP4 causes the progress of the disease.
23677744 Aquaporin-4 antibody-positive patients should be included in the neuromyelitis optica spectrum even if they don't fulfill diagnostic criteria.
23673145 We examined whether Multiple Sclerosis (MS) patients recognize antigenic epitopes on AQP4 that may define distinct disease subsets.
23664693 We compared human AQP4 to plant and bacterial proteins to investigate the occurrence of significantly similar structures and sequences.
23658379 Patients diagnosed with AQP4-antibody-negative neuromyelitis optica express specific demographic and disease-related features.
23456674 conclude that high AQP4 antibody levels are associated with the occurrence of ON, but that the antibody levels themselves are not closely correlated with the onset of relapse
23378324 Both cognitive impairment and substantial cortical neuronal loss are demonstrated with unique AQP4 dynamics in astrocytes from neuromyelitis optica patients.
23270503 Astrocytes express aquaporin 4, the water channel protein, involved in water homeostasis and edema formation
23232103 In a sample of patients with multiple sclerosis, aquaporin-4 antibodies were detected in CSF but not serum.
23116879 Genetic variation in AQP4 may account for the susceptibility to AQP4-Ab-positive neuromyelitis optica and its spectrum disorders in Southern Han Chinese population.
23054238 AQP4 expression associates with spinal cord lesions in two cases of neuromyelitis optica.
23008451 An autoimmune response against Aqp4 in neuromyelitis optica may be triggered by infection-induced cross-immunoreactivity and presents a new perspective on the pathogenesis of this disease.
22987438 Compared with brain astrocytes, Muller cells (a class of retinal macroglia) exhibit higher levels of AQP4.
22925751 The frequency of anti-AQP4 in recurrentMacute transverse myelitis was 26.9%, increasing to 41.2% among extensive transverse myelitis
22906356 neuromyelitis optica-IgG binds most avidly to plasma membrane surface AQP4 epitopes formed by loop interactions within tetramers and by intermolecular interactions within high order structures.
22886979 The expression of AQP4 mRNA in Muller cells was increased by VEGF.
22829325 Presence of AQP4 antibodies is associated with the conversion rate from transverse myelitis to neuromyelitis optica.
22817997 Based on these initial results, we believe [11C]TGN-020 PET will be valuable in determining the role of AQP-4 in disease progression, and for the clinical assessment of water homeostasis under various settings.
22808259 The differential expressions of AQP3 and AQP4 may reflect the biological nature and/or function of normal, hyperplastic, and neoplastic thyroid cells and additionally may have value in determining differential diagnoses of thyroid tumors.
22802001 The subcellular co-localisation of K(ir)4.1 and AQP4 in the supporting cells of the cochlea described in this study resembles that of the astroglia of the central nervous system and the glial Mueller cells in the retina.
22777185 AQP4 mRNA expression is downregulated by hypoxia and ischemia.
22773464 Our findings suggest differential expression patterns of MMP-9 and AQP4 in different grades of gliomas
22732097 The potential functions of AQP2 and AQP5 in the inner ear are in the resorption and secretion of endolymph. (Review)
22718347 AQP4 orthogonal arrays of particles were imaged with ~20 nm spatial precision by photoactivation localization microscopy.
22714714 Reduced expression of cell surface AQP-4 is characteristic of glioblastoma multiforme patients without seizures, likely attributable to a posttranslational mechanism.
22679274 AQP4 gene expression was significantly higher in miRNA-203 down-regulated asthmatic airway epithelia.
22628234 NMO-IgG against aquaporin-4 (AQP4) is a specific marker for neuromyelitis optica (NMO). We evaluated the performance of different NMO-IgG detecting methods.ELISA-AQP4 may be more sensitive and specific when confirmed by IIF-AQP4.
22608667 [review] The evidence that AQP4-IgG is involved in the development of neuromyelitis optica has revolutionised our understanding of the disease, yet important unanswered questions remain.
22554469 Structural features of aquaporin 4 supporting the formation of arrays and junctions in biomembranes
22540328 The presence and severity of CCVSI in multiple sclerosis correlate with disease status but has no or very limited association with clinical disability.
22526930 Flow cytometry and bridging ELISA are useful for detecting and quantifying anti-AQP4 antibodies in neuromyelitis optica.
22507888 Seropositivity for AQP4-IgG antibody occurs predominantly in females, particularly in individuals older than 18 years. Elderly women are more likely to be seropositive than individuals in other age categories.
22394609 Patchy areas of AQP4 loss are observed in spinal cord of mice transferred with IgG from AQP4 antibody-positive neuromyelitis optica patients.
22393049 Complement-dependent cytotoxicity in neuromyelitis optica requires aquaporin-4 protein assembly in orthogonal arrays
22378467 This review showed that the potential roles of the glial water channel aquaporin-4 (AQP4) in modulation of brain excitability and in epilepsy.
22372348 we found AQP1 and AQP4 in lung cancer cell extravasation and spread, which may provide a functional explanation for the expression of AQP1 and AQP4 in lung cancer tissues and lung cancer cell lines.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22334710 miR-130a was identified as a strong transcriptional repressor of the AQP4 M1 isoform.
22307776 AQP4 expression was increased in glioblastoma compared to control tissue.
22291033 In Sjogren's syndrome, the presence of anti-AQP4 antibodies is associated with involvement of the optic nerve, cerebrum and brainstem, and with cervical posterior column lesions in the spinal cord.
22248725 The sensitivity of anti-AQP4 antibodies in the cerebrospinal fluid is higher than that in serum; their combined use is helpful in diagnosing Chinese patients with neuromyelitis optica.
22083667 mRNA expressions of AQP4 and TH were found to be reduced whereas that of PBP was found to be elevated when compared with those of healthy control samples
22069320 Evidence against cellular internalization in vivo of NMO-IgG, aquaporin-4, and excitatory amino acid transporter 2 in neuromyelitis optica.
21981006 Post-Golgi and membrane curvature-dependent orthogonal arrays of particles (OAPs)assembly may be important for vesicle transport of AQP4 in the secretory pathway and AQP4-facilitated astrocyte migration.
21968684 study concludes that AQP4 is involved in peritumoral brain edema formation in meningiomas and is also closely related to the expression of VEGF.
21965418 Established an AQP4-Ab ELISA, which could be a potential monitoring tool for disease activity in neuromyelitis optica.
21952128 A heterozygous missense mutation in the aquaporin-4 (AQP4) gene leading to an Asp/Glu amino acid substitution at position 184 was identified in a patient with hearing loss
21914143 Our genetic case-control study did not indicate an association between AQP4 gene variants and Idiopathic intracranial hypertension.
21909659 These cases may enhance the understanding of the genetic contribution to NMO. Our findings suggest that familial history must be carefully examined in patients with NMO.
21908481 Case Report: presence of anti-AQP4 antibodies, and the pathology, led to the diagnosis of anti-AQP4 antibodies-related encephalopathy.
21900637 Except for one uncommon single nucleotide polymorphism (SNP), no tested SNP is associated with neuromyelitis optica (NMO), providing no support for the hypothesis that genetic variation in AQP4 accounts for overall susceptibility to NMO.
21896312 AQP4 had a tendency to be increased in bacterial meningitis patients, however the difference was not significant (BM: 1.8+/-3.1ng/ml, controls: 0.1+/-0.2ng/ml; p=0.092).
21813785 AQP4 antibodies are highly prevalent in Thai patients with idiopathic inflammatory demyelinating central nervous system diseases.
21784068 REVIEW: summarizes literature data concerning the involvement of AQP-1 and -4 in human brain tumor growth and edema formation
21689527 Model predictions were tested by total internal reflection fluorescence microscopy of AQP4-green-fluorescent protein chimeras and native gel electrophoresis of cells expressing different isoform M23:M1 ratios.
21621278 Neuromyelitis optica-associated mutations Arg19Ile and Arg19Thr in aquaporin-4 do not affect orthogonal array of particles assembly.
21548930 variable expression of AQPs in NSCLC and normal lung; found differences between NSCLC subtypes and AQP expresson; higher transcript and protein levels of AQP4 in well-differentiated lung adenocarcinomas suggest association with more favourable prognosis
21524183 AQP4 immunoreactivity (AQP4-IR) was present on the basolateral membranes of acinar and ductal cells in control and diseased LGs, with ductal cells showing stronger AQP4-IR than acinar cells.
21454592 Binding affinity and specificity of neuromyelitis optica autoantibodies to aquaporin-4 M1/M23 isoforms and orthogonal arrays.
21424125 AQP4 is involved in the control of glioblastoma cell migration and invasion.
21333492 epitope mapping for AQP4 reveals that a significant proportion of anti-AQP4 antibodies target linear epitopes localized in the intracellular domains of the channel
21321193 The IL-6-dependent B-cell subpopulation is involved in the pathogenesis of neuromyelitis optica, thereby providing a therapeutic strategy for targeting IL-6 receptor signaling.
21303170 It was found that water dipole orientation within the constriction region of the channel is affected by electric fields (e-fields) and that this governs the permeability - a molecular dynamics study.
21300735 Case Report: Neuromyelitis optica spectrum disorder patient with anti-AQP4 antibody displaying WEBINO syndrome.
21262839 astrocytes contain a TRPV4/AQP4 complex that constitutes a key element in the brain's volume homeostasis by acting as an osmosensor that couples osmotic stress to downstream signaling cascades.
21252246 Presence of AQP1-4 in human follicles during ovulation.
21241398 This study findings suggested that antibody-independent AQP4 loss can occur in heterogeneous demyelinating conditions, including neuromyelitis optica , Balo's disease and multiple sclerosis.
21212277 Identification of two major conformational aquaporin-4 epitopes for neuromyelitis optica autoantibody binding
21107133 In cases of Alzeimer's disease and cerebral amyloid angiopathy, aquaporin 4 expression is enhanced, when compared to AQP4 expression in control brain.
21107126 The natural history of patients with positive neuromyelitis optica (AQP4) antibodies makes it possible to recognize the poor prognosis associated with these antibodies, which are highly specific.
21063116 After sequencing analysis of the coding regions and exon-intron boundaries one single variation, no significant mutation in AQP 4 was found.
21063116 Observational study of gene-disease association. (HuGE Navigator)
20965731 Expression of AQP4 in pediatric brain tumors. Increased in ependymomas in posterior fossa and in pilocytic astrocytomas. Not expressed in medulloblastoma, primitive neuroectodermal tumor, germinoma.
20953960 Seropositivity of aquaporin-4 in a single-center cohort may have prognostic significance in Turkish neuromyelitis optica patients.
20934410 The patients with FCD type IIB, severe malformation in cortical development, the protein was more expressed and the distribution pattern of AQP4 immunoreactivity was different, being strong in the neuropil and around several dysplastic neurons.
20728226 Thymoma cells of patients with and without myasthenia gravis express aquaporin-4.
20685122 This review focuses on the newly discovered functions and molecular mechanisms of AQP4 in infiltrative gliomas.
20680636 These findings suggest that AQP4 loss occurs in heterogeneous demyelinating conditions, namely neuromyelitis optica and Balo's concentric sclerosis
20628061 Data identify miR-320a as a potential modulator of aquaporin 1 and 4 and explore the possibility of using miR-320a to alter the expression of aquaporin 1 and 4 in normal and ischemic conditions.
20577926 High expression of AQP4 accelerates the water absorption in colon mucosa and may be one of the crucial events in the development of slow transit constipation.
20467785 AQP4 protein expression in the tumor was significantly positively correlated with both VEGF protein (r = 0.877, P < 0.001) and HIF-1alpha protein (r = 0.876, P < 0.001).
20463974 AQP4-IgG Abs are significantly associated with a higher number of relapses and longer disease duration.
20461409 Expression of AQP1, AQP4, or AQP6 mRNA did not differ in vestibular endorgans from patients with Meniere's disease.
20351659 Data indicate that an aquaporin 4 polymorphism may be a predisposing factor for SIDS, and that CT/TT genotypes are associated with an increased brain/body weight ratio in infants dying from SIDS during the vulnerable period from birth up to 3 mo of age.
20351659 Observational study of gene-disease association. (HuGE Navigator)
20339523 This review summarizes the papers which describe the expression of OAs, AQP4, and other AQPs at the sarcolemma of healthy and diseased muscle and discusses the possible role of AQPs, especially that of AQP4, in normal and pathological skeletal muscles.
20232212 We found an absence of aquaporin-4 antibodies in patients with idiopathic intracranial hypertension.
20227773 characterized the expression pattern of these AQP4 isoform mRNAs in humans and found a pattern of AQP4 expression that correlates with Neuromyelitis optica disease localization
20141731 The gene expressions of AQP3 and AQP4 in gastric mucosa are different in patients with various degrees of spleen-stomach dampness-heat syndrome of chronic superficial gastritis.
20138100 Aquaporin-4 (AQP4) is a key molecule for maintaining water and ion homeostasis associated with neuronal activity in the central nervous system--REVIEW
20131265 Autoantibodies against AQP-4 are a valuable serologic marker that discriminates a small subgroup of patients in whom therapeutic strategies for igg antibodies are found.
20109536 Here we review and discuss the potential significance of changes in the AQP4 expression in spinal cord injury that generates glial fibrillary acidic protein (GFAP)-labeled astrocytes devoid of AQP4, and GFAP-labeled astroglia that overexpress AQP4
20106632 AQP3, 4 & 5 exhibited differential expression between human gastric carcinoma and corresponding normal tissue; AQP4 protein was expressed mainly in membrane of parietal cell & chief cell in normal gastric mucosa, & absent in carcinoma tissue
20028711 HLA-DRB1 alleles influence susceptibility to anti-aquaporin 4 antibody positive multiple sclerosis in Japanese patients.
20013023 A specific role for AQP4 in square array formation and water permeability.
20007705 In cells transiently transfected with AQP4-M1 coding sequence we observed besides AQP4-M1 the additional presence of the AQP4-M23 isoform associated with the formation of typical orthogonal arrays of particles.
19965522 Anti-Helicobacter pylori neutrophil-activating protein antibody may be associated with the pathology of anti-aquaporin-4 autoimmunity in Japanese patients with multiple sclerosis and neuromyelitis optica.
19938104 Cerebrospinal fluid aquaporin-4 is an early biomarker in the diagnosis of neuromyelitis optica.
19864112 Variations in the AQP4 and the KCNJ10/KCNJ9 region are likely to be associated with temporal lobe epilepsy.
19864112 Observational study of gene-disease association. (HuGE Navigator)
19806476 These data demonstrate that following experimental stroke AVP V(1) receptor antagonism: (1) attenuates injury volume and ischemia-evoked cerebral edema; (2) modulates AQP4 expression.
19772916 TXA(2) receptor mediates water influx through aquaporins in astrocytoma cells via TXA(2) receptor-mediated activation of G alpha(12/13), Rho A, Rho kinase and Na(+)/H(+)-exchanger.
19764565 Higher expressions of AQP4 were found in the brain tumors and adjacent tissues in the patients with glioblastoma than in the normal controls.
19761816 PKC regulates AQP4 function in glioma cells through phosphorylation on S180 leading to reduced water permeability and enhanced water permeability when de-phosphorylated
19752303 In this large, clinical practice-based study, AQP4 NMO-IgG detected by IF or IP was highly specific for NMO spectrum disorders. The IP assay was significantly less sensitive than IF. Combined testing improved sensitivity by 5%.
19487655 We report a case of neuromyelitis optica seropositive for aquaporin-4 antibody more than 10 years before onset.
19465451 Anti-AQP4 antibody-positive patients are immunologically distinct from anti-AQP4 antibody-negative opticospinal multiple sclerosis patients.
19445480 Accessory isoforms AQP4a and AQP4e, while not being able to form square arrays alone, are able to interact with functional isoform AQP4c and be incorporated into higher-order structures.
19383790 The 1.8-A crystal structure of AQ4 reveals the molecular basis for the water selectivity of the channel.
19366470 Role for AQP4 in fluid regulation in inner retina. AQP4 channels are likely a conduit for facilitating fluid homeostasis in inner retina during light activation, are likely to play a consequent role in the regulation of ocular volume and growth. [Review]
19266146 We describe a case of narcolepsy as an initial manifestation of neuromyelitis optica with anti-aquaporin-4 antibody.
19209385 Observational study of gene-disease association. (HuGE Navigator)
19153045 Aquaporin 4 overexpression can lead to abnormal water transport and edema formation in meningiomas.
19140826 the emergence of anti-AQP4 antibody is reinforced by the presence of the HLA-DPB1*0501 allele in Japanese.
19112001 We measured the expression and localization of AQP4 in 60 gastric epithelial tumor cases and 10 normal tissue cases. AQP4 protein and mRNA expression level in gastric cancer tissue were significantly lower than those in normal gastric tissue.
19028829 hypercomplementemia in anti-AQP4 antibody-positive patients may reflect a systemic inflammatory reaction at relapse in multiple sclerosis
19000426 Secondary edema and brain damage may correlate with the expression of the AQP-4 mRNA in the peri-hematoma brain edema area.
18854171 These observations indicate that the C-terminal domain of AQP4 is constitutively phosphorylated at least in part by protein kinase CK2 and it is required for Golgi transition.
18836575 This study was designed to analyze changes in the expression of AQP4 following elevation of intraocular pressure (IOP) and after intravitreal endothelin-1 injection and the potential involvement of the ubiquitin-dependent proteasome.
18641458 AQP4 expression was analyzed in muscle biopsies from patients affected by Limb Girdle Muscular Dystrophies.
18516975 may be involved in the pathogenesis of Neuromyelitis optica.
18511455 24 variants in AQP4 including four novel nsSNPs (I128T, D184E, I205L and M224T) were identified.
18510734 Changes in AQP4 expression & blood-brain barrier integrity, both of which can be regulated by CNS inflammation, contribute to inductive events for anti-AQP4-specific immune response in neuromyelitis optica. Review.
18474738 Aquaporin-4-specific IgG in some cases of NMO may reflect a paraneoplastic immune response. The clinical utility of this autoantibody as a cancer marker warrants prospective investigation.
18462810 Elevated anti-AQP4 antibody titers in serum were found in 15 (71%) of 21 patients with neuromyelitis optica, 4.3% of 46 patients with multiple sclerosis, none of 51 normal controls, and 2.6% of 115 patients with other neurological diseases.
18437047 Presence of anti-AQP4 antibodies correlates with clinical severity and poor prognosis in opticospinal multiple sclerosis.
18435417 These data suggest that changes are apparent in markers for abnormal glial-neuronal communication (connexin 43 and aquaporin 4) in brains of subjects with autism.
18392839 Our study shows that AQP4 downregulation can occur in muscular dystrophies with either normal or disrupted expression of dystrophin-associated proteins, and that this might be associated with upregulation of AQP1.
18309154 genetic variation in AQP4 might contribute to brain edema formation after middle cerebral artery occlusion
18309154 Observational study of gene-disease association. (HuGE Navigator)
18280225 AQP4 is not expressed in human airway epithelial cells from the A549 adeoncarcinoma cell line.
18095136 Upregulation of APQ4 by tumor cells and reactive astroglia were major factors of cerebral edema
18071147 Review highlights an understanding of the major role of aquaporin-4 in maintenance of the microenvironment of neurons, axons, and oligodendrocytes and its importance as a therapeutic target in neurologic disease.
18019416 AQP4-mediated maternal-fetal fluid exchange could play an important role in the control of ion homeostasis and water balance in the human placenta throughout pregnancy
17984171 upregulated expression of chromosome 21 genes such as S100B and amyloid precursor protein activated the stress response kinase pathways, and furthermore, could be linked to upregulation of the water channel aquaporin 4 in Down syndrome neural progenitors
17899684 increased AQP-4 expression in sCJD is an early pathologic event and appears to remain until the late disease stage
17890008 Observational study of gene-disease association. (HuGE Navigator)
17890008 We did not find any variation in exon 4 of the AQP4 gene in our considerable large sample of traumatic brain edema.
17549682 Only the presence of AQP1, but not AQP4, enhanced cell growth and migration, typical properties of gliomas, while AQP4 enhanced cell adhesion suggesting differential biological roles for AQP1 and AQP4 in glioma cell biology.
17335082 Unexpectedly high AQP4 levels in pilocytic astrocytomas and present AQP4 as tumor progression marker in WHO grade II-IV astrocytomas.
16871401 Significant increased expression levels of AQP1 and AQP4 were seen in Creutzfeldt-Jakob disease, but not in advanced Alzheimer's disease and diffuse Lewy body disease.
16831965 The distribution of NMO-characteristic brain lesions corresponds to sites of high AQP4 expression in neuromyelitis optica
16814974 These results in human fetal brain lend morphological support to the previous findings that aquaporin-1 and aquaporin-4 play different roles in the regulation of the water homeostasis of the brain.
16778375 Astrocytic impairment and humoral immunity against AQP4 may be primarily involved in the lesion formation of NEUROMYELITIS OPTICA, contrarely to MULTIPLE SCLEROSIS in which demyelination is the primary pathology.
16194264 Observational study of gene-disease association. (HuGE Navigator)
16133546 Up-regulation of AQP4 was found in astrocytes in various inflammatory lesions. Distribution of AQP4-positve astrocytes differed according to disease and was'nt related to brain edema. Thus, functions and regulation of AQP4 in human brains are multiple.
16103109 aquaporin-4 has species-specific roles in astrocytes and a functional relationship with Connexin43
15200272 The expression of AQP4 is affected by nerve supply and is down-regulated in human muscles with neurogenic atrophy.
14753493 Increased expression. Over-expression occurred on astrocytic processes. Induction of AQP1 and AQP4 on reactive astrocytes in subarachnoid hemorrhage. May be involved in brain edema formation or resolution.
14627352 AQP4 mRNA failed to localize in parietal cells but was identified in neighboring mucosal cells that were triangular in shape and smaller than parietal cells in size, and in columnar cells at the base of the gastric gland.
12715185 Restricted to astrocytes. Detectable in subpial and subependymal zone in normal condition. More intense in ischemic foci. May reflect participation in development of brain edema in human brains by playing role in water transport.

AA Sequence

MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDM      1 - 70
VLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPS     71 - 140
VVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGA    141 - 210
SMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEV    211 - 280
EDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV                               281 - 323
//

Text Mined References (236)

PMID Year Title
26786101 2016 Structural Determinants of Oligomerization of the Aquaporin-4 Channel.
26638215 2016 Effect of estrogen and/or progesterone administration on traumatic brain injury-caused brain edema: the changes of aquaporin-4 and interleukin-6.
26530185 2015 Highly encephalitogenic aquaporin 4-specific T cells and NMO-IgG jointly orchestrate lesion location and tissue damage in the CNS.
26512424 2015 Control of the Aquaporin-4 Channel Water Permeability by Structural Dynamics of Aromatic/Arginine Selectivity Filter Residues.
26419740 2015 Heterogeneity of aquaporin-4 localization and expression after focal cerebral ischemia underlies differences in white versus grey matter swelling.
26287441 2015 Immunization of mice with a peptide derived from the HTLV-1 TAX1BP1 protein induces cross-reactive antibodies against aquaporin 4.
26261083 2015 Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema.
26115524 2015 Water Channels Aquaporin 4 and -1 Expression in Subependymoma Depends on the Localization of the Tumors.
26013827 2015 Identification and Molecular Mechanisms of the Rapid Tonicity-induced Relocalization of the Aquaporin 4 Channel.
26000774 2015 Aquaporin-4 gene variant independently associated with oedema after intracerebral haemorrhage.
25913278 2015 Resolution of aquaporin-4 antibodies in a woman with neuromyelitis optica treated with human autologous stem cell transplant.
25839357 2015 Challenging AQP4 druggability for NMO-IgG antibody binding using molecular dynamics and molecular interaction fields.
25792738 2015 Mutagenesis of the aquaporin 4 extracellular domains defines restricted binding patterns of pathogenic neuromyelitis optica IgG.
25677878 2015 Diagnostic value of aquaporin 4 antibody in assessing idiopathic inflammatory demyelinating central nervous system diseases in Egyptian patients.
25668569 2015 Reduction in serum aquaporin-4 antibody titers during development of a tumor-like brain lesion in a patient with neuromyelitis optica: a serum antibody-consuming effect?
25460197 2015 NADPH oxidase activation and 4-hydroxy-2-nonenal/aquaporin-4 adducts as possible new players in oxidative neuronal damage presents in drug-resistant epilepsy.
25306413 2014 The function of aquaporin4 in ischemic brain edema.
25257965 2015 Internalization of aquaporin-4 after collagenase-induced intracerebral hemorrhage.
25239624 2014 Identification of a point mutation impairing the binding between aquaporin-4 and neuromyelitis optica autoantibodies.
25160125 2014 Sudden onset of sleep due to hypothalamic lesions in neuromyelitis optica spectrum disorder positive for anti-aquaporin-4 antibody.
25128605 2014 Targeting of aquaporin 4 into lipid rafts and its biological significance.
25096173 2014 Human aquaporin 4 gene polymorphisms in Chinese patients with neuromyelitis optica.
25027061 2014 Antibodies to neural and non-neural autoantigens in Japanese patients with CNS demyelinating disorders.
25013167 2014 Evidence of efficient stop codon readthrough in four mammalian genes.
24999750 2014 AQP4 tag single nucleotide polymorphisms in patients with traumatic brain injury.
24888368 2014 Osmotic stress decreases aquaporin-4 expression in the human retinal pigment epithelial cell line, ARPE-19.
24866202 2014 Relapsing inappropriate antidiuretic hormone secretion in an anti-aquaporin-4 antibody positive paediatric patient.
24733266 2014 Paraneoplastic neuromyelitis optica spectrum disorder associated with metastatic carcinoid expressing aquaporin-4.
24727946 2014 Aquaporin-4 polymorphisms and brain/body weight ratio in sudden infant death syndrome (SIDS).
24582793 Association of rs2075575 and rs9951307 polymorphisms of AQP-4 gene with leukoaraiosis.
24415568 2014 Distinction between MOG antibody-positive and AQP4 antibody-positive NMO spectrum disorders.
24388217 2014 Immunopathogenesis of neuromyelitis optica.
24361961 2014 Lack of association between AQP4 polymorphisms and risk of inflammatory demyelinating disease in a Korean population.
24356448 2014 A novel human aquaporin-4 splice variant exhibits a dominant-negative activity: a new mechanism to regulate water permeability.
24289379 2013 Human aquaporin 4 gating dynamics under and after nanosecond-scale static and alternating electric-field impulses: a molecular dynamics study of field effects and relaxation.
24260168 2013 Aquaporin-4 autoantibodies in Neuromyelitis Optica: AQP4 isoform-dependent sensitivity and specificity.
24252214 2013 Evidence of aquaporin involvement in human central pontine myelinolysis.
24182872 2013 Aquaporin-4 antibodies, CNS acidosis and neuromyelitis optica: a potential link.
24029914 2014 Aquaporin-4 antibody-positive myelitis initially biopsied for suspected spinal cord tumors: diagnostic considerations.
24014171 2013 Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology.
23997151 2013 Updated estimate of AQP4-IgG serostatus and disability outcome in neuromyelitis optica.
23973312 2013 Chronic ceftriaxone treatment rescues hippocampal memory deficit in AQP4 knockout mice via activation of GLT-1.
23950863 2013 Knockdown a water channel protein, aquaporin-4, induced glioblastoma cell apoptosis.
23928039 2013 Expression analysis and clinical correlation of aquaporin 1 and 4 genes in human hippocampal sclerosis.
23915916 2013 Aquaporin-4 in glioma and metastatic tissues harboring 5-aminolevulinic acid-induced porphyrin fluorescence.
23746426 2013 Establishment of monoclonal antibodies against the extracellular domain that block binding of NMO-IgG to AQP4.
23677744 2013 Aquaporin-4 antibody-positive cases beyond current diagnostic criteria for NMO spectrum disorders.
23673145 2013 Reactivity to AQP4 epitopes in relapsing-remitting multiple sclerosis.
23664693 2013 Aquaporin 4 molecular mimicry and implications for neuromyelitis optica.
23658379 2013 Aquaporin-4 antibody-negative neuromyelitis optica: distinct assay sensitivity-dependent entity.
23456674 2013 Clinical relevance of serum aquaporin-4 antibody levels in neuromyelitis optica.
23378324 2013 Cognitive impairment and cortical degeneration in neuromyelitis optica.
23270503 2012 Aquaporin 4: a player in cerebral edema and neuroinflammation.
23232103 2013 Clinical features of Chinese patients with multiple sclerosis with aquaporin-4 antibodies in cerebrospinal fluid but not serum.
23116879 2013 Preliminary study on the association of AQP4 promoter polymorphism with anti-aquaporin-4 antibody positivity in southern Han Chinese patients with idiopathic demyelinating disorders of central nervous system.
23054238 2012 Two cases of lumbosacral myeloradiculitis with anti-aquaporin-4 antibody.
23008451 2012 Cross-immunoreactivity between bacterial aquaporin-Z and human aquaporin-4: potential relevance to neuromyelitis optica.
22987438 2012 Molecular scaffolds underpinning macroglial polarization: an analysis of retinal Müller cells and brain astrocytes in mouse.
22925751 2012 Anti-AQP(4) antibody in idiopathic acute transverse myelitis with recurrent clinical course: frequency of positivity and influence in prognosis.
22906356 2013 Astrocytic autoantibody of neuromyelitis optica (NMO-IgG) binds to aquaporin-4 extracellular loops, monomers, tetramers and high order arrays.
22886979 2012 Effects of avastin on expression of AQP4 in Müller cells under hypoxia.
22829325 2013 Distinct features between longitudinally extensive transverse myelitis presenting with and without anti-aquaporin 4 antibodies.
22817997 2013 Aquaporin-4 positron emission tomography imaging of the human brain: first report.
22808259 2012 Differential expression of aquaporins and its diagnostic utility in thyroid cancer.
22802001 2012 Co-localisation of K(ir)4.1 and AQP4 in rat and human cochleae reveals a gap in water channel expression at the transduction sites of endocochlear K(+) recycling routes.
22777185 2012 Aquaporin-4 in the heart: expression, regulation and functional role in ischemia.
22773464 2012 Differential expression of MMP-9 and AQP4 in human glioma samples.
22732097 Water channel proteins in the inner ear and their link to hearing impairment and deafness.
22718347 2012 Super-resolution imaging of aquaporin-4 orthogonal arrays of particles in cell membranes.
22714714 2012 Different aquaporin-4 expression in glioblastoma multiforme patients with and without seizures.
22679274 2012 Distinct microRNA expression in human airway cells of asthmatic donors identifies a novel asthma-associated gene.
22628234 2012 Detection of anti-aquaporin-4 antibodies in neuromyelitis optica: comparison of tissue-based and cell-based indirect immunofluorescence assays and ELISA.
22608667 2012 Aquaporin 4 and neuromyelitis optica.
22554469 2012 Structural features of aquaporin 4 supporting the formation of arrays and junctions in biomembranes.
22540328 2012 Aquaporin-4 expression in distal myopathy with rimmed vacuoles.
22526930 2012 Quantitative assays for anti-aquaporin-4 antibody with subclass analysis in neuromyelitis optica.
22507888 2012 Effects of age and sex on aquaporin-4 autoimmunity.
22394609 2012 Aquaporin-4 autoantibodies cause asymptomatic aquaporin-4 loss and activate astrocytes in mouse.
22393049 2012 Complement-dependent cytotoxicity in neuromyelitis optica requires aquaporin-4 protein assembly in orthogonal arrays.
22378467 2012 Aquaporin-4 and epilepsy.
22372348 2012 Aquaporin 1 and aquaporin 4 are involved in invasion of lung cancer cells.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22334710 2012 MicroRNA-130a represses transcriptional activity of aquaporin 4 M1 promoter.
22328087 2012 Megalencephalic leukoencephalopathy with subcortical cysts protein 1 functionally cooperates with the TRPV4 cation channel to activate the response of astrocytes to osmotic stress: dysregulation by pathological mutations.
22307776 2012 Dynamics of expression patterns of AQP4, dystroglycan, agrin and matrix metalloproteinases in human glioblastoma.
22291033 2012 Comparison of clinical, immunological and neuroimaging features between anti-aquaporin-4 antibody-positive and antibody-negative Sjogren's syndrome patients with central nervous system manifestations.
22248725 2012 Aquaporin 4 antibodies in the cerebrospinal fluid are helpful in diagnosing Chinese patients with neuromyelitis optica.
22083667 2012 Peripheral assessment of the genes AQP4, PBP and TH in patients with Parkinson's disease.
22069320 2011 Evidence against cellular internalization in vivo of NMO-IgG, aquaporin-4, and excitatory amino acid transporter 2 in neuromyelitis optica.
21981006 2012 Post-Golgi supramolecular assembly of aquaporin-4 in orthogonal arrays.
21968684 2011 Expression of aquaporin-4 in human supratentorial meningiomas with peritumoral brain edema and correlation of VEGF with edema formation.
21965418 2012 Quantitative measurement of anti-aquaporin-4 antibodies by enzyme-linked immunosorbent assay using purified recombinant human aquaporin-4.
21952128 2011 D184E mutation in aquaporin-4 gene impairs water permeability and links to deafness.
21914143 2013 Is the brain water channel aquaporin-4 a pathogenetic factor in idiopathic intracranial hypertension? Results from a combined clinical and genetic study in a Norwegian cohort.
21909659 2011 Anti-aquaporin-4 antibody-positive familial neuromyelitis optica in mother and daughter.
21908481 2012 Pathological study of subacute autoimmune encephalopathy with anti-AQP4 antibodies in a pregnant woman.
21900637 2011 Genetic analysis of aquaporin-4 in neuromyelitis optica.
21896312 2011 Aquaporins AQP1 and AQP4 in the cerebrospinal fluid of bacterial meningitis patients.
21813785 2011 AQP4 antibody-positive Thai cases: clinical features and diagnostic problems.
21784068 2011 Role of aquaporins in cell migration and edema formation in human brain tumors.
21689527 2011 Model of aquaporin-4 supramolecular assembly in orthogonal arrays based on heterotetrameric association of M1-M23 isoforms.
21621278 2011 Orthogonal array formation by human aquaporin-4: examination of neuromyelitis optica-associated aquaporin-4 polymorphisms.
21548930 2011 Loss of aquaporin-4 expression and putative function in non-small cell lung cancer.
21524183 2011 Changes of aquaporins in the lacrimal glands of a rabbit model of Sjögren's syndrome.
21491501 2011 Aquaporin-4 Mz isoform: brain expression, supramolecular assembly and neuromyelitis optica antibody binding.
21454592 2011 Binding affinity and specificity of neuromyelitis optica autoantibodies to aquaporin-4 M1/M23 isoforms and orthogonal arrays.
21424125 2011 Role of aquaporin-4 in the regulation of migration and invasion of human glioma cells.
21333492 2011 Fine specificity of antibodies against AQP4: epitope mapping reveals intracellular epitopes.
21321193 2011 Interleukin 6 signaling promotes anti-aquaporin 4 autoantibody production from plasmablasts in neuromyelitis optica.
21303170 2011 Human aquaporin 4 gating dynamics in dc and ac electric fields: a molecular dynamics study.
21300735 2011 Wall-eyed bilateral internuclear ophthalmoplegia (WEBINO) syndrome in a patient with neuromyelitis optica spectrum disorder and anti-aquaporin-4 antibody.
21262839 2011 An aquaporin-4/transient receptor potential vanilloid 4 (AQP4/TRPV4) complex is essential for cell-volume control in astrocytes.
21252246 2011 The water permeability channels aquaporins 1-4 are differentially expressed in granulosa and theca cells of the preovulatory follicle during precise stages of human ovulation.
21251984 2011 Water permeability and characterization of aquaporin-11.
21241398 2011 Reappraisal of aquaporin-4 astrocytopathy in Asian neuromyelitis optica and multiple sclerosis patients.
21212277 2011 Identification of two major conformational aquaporin-4 epitopes for neuromyelitis optica autoantibody binding.
21107133 2010 Aquaporin expression in the brains of patients with or without cerebral amyloid angiopathy.
21107126 2010 Should most patients with optic neuritis be tested for neuromyelitis optica antibodies and should this affect their treatment?
21063116 2010 Molecular analysis of aquaporin genes 1 to 4 in patients with Menière's disease.
20965731 2011 Expression of AQP1 and AQP4 in paediatric brain tumours.
20953960 2011 Prognostic implications of aquaporin-4 antibody status in neuromyelitis optica patients.
20934410 2011 Aquaporin 4 expression in control and epileptic human cerebral cortex.
20728226 2010 Aquaporin-4 water channel expression by thymoma of patients with and without myasthenia gravis.
20685122 2010 Aquaporin-4 in glioma invasion and an analysis of molecular mechanisms.
20680636 2010 Aquaporin-4 astrocytopathy in Baló's disease.
20628061 2010 MicroRNA 320a functions as a novel endogenous modulator of aquaporins 1 and 4 as well as a potential therapeutic target in cerebral ischemia.
20577926 2010 [Expression and significance of aquaporin 4 in the colonic mucosa of patients with slow transit constipation].
20467785 2010 AQP-4 in peritumoral edematous tissue is correlated with the degree of glioma and with expression of VEGF and HIF-alpha.
20463974 2010 Patterns of antibody binding to aquaporin-4 isoforms in neuromyelitis optica.
20461409 2010 Immunohistochemical localization and mRNA expression of aquaporins in the macula utriculi of patients with Meniere's disease and acoustic neuroma.
20351659 2010 Aquaporin-4 gene variation and sudden infant death syndrome.
20339523 2010 Aquaporin expression in normal and pathological skeletal muscles: a brief review with focus on AQP4.
20232212 2010 Absence of aquaporin-4 antibodies in patients with idiopathic intracranial hypertension.
20227773 2010 Differential expression of aquaporin-4 isoforms localizes with neuromyelitis optica disease activity.
20141731 2010 Relationship between gene expressions of aquaporin 3 and 4 and various degrees of spleen-stomach dampness-heat syndrome in chronic superficial gastritis.
20138100 2010 Beyond water channel: aquaporin-4 in adult neurogenesis.
20131265 2010 Autoantibodies against aquaporin-4 in patients with neuropsychiatric systemic lupus erythematosus and primary Sjögren's syndrome.
20109536 2010 Aquaporins in spinal cord injury: the janus face of aquaporin 4.
20106632 2010 Expression profile of multiple aquaporins in human gastric carcinoma and its clinical significance.
20028711 2010 Influence of HLA-DRB1 alleles on the susceptibility and resistance to multiple sclerosis in Japanese patients with respect to anti-aquaporin 4 antibody status.
20013023 2010 Differential water permeability and regulation of three aquaporin 4 isoforms.
20007705 2010 Evidences for a leaky scanning mechanism for the synthesis of the shorter M23 protein isoform of aquaporin-4: implication in orthogonal array formation and neuromyelitis optica antibody interaction.
19965522 2009 Association of anti-Helicobacter pylori neutrophil-activating protein antibody response with anti-aquaporin-4 autoimmunity in Japanese patients with multiple sclerosis and neuromyelitis optica.
19938104 2009 Intrathecal pathogenic anti-aquaporin-4 antibodies in early neuromyelitis optica.
19864112 2010 Variants of the genes encoding AQP4 and Kir4.1 are associated with subgroups of patients with temporal lobe epilepsy.
19806476 2010 Arginine-vasopressin V1 but not V2 receptor antagonism modulates infarct volume, brain water content, and aquaporin-4 expression following experimental stroke.
19772916 2010 Involvement of aquaporin in thromboxane A2 receptor-mediated, G 12/13/RhoA/NHE-sensitive cell swelling in 1321N1 human astrocytoma cells.
19764565 2009 [AQP4 expression in the brains of patients with glioblastoma and its association with brain edema].
19761816 2010 Water permeability through aquaporin-4 is regulated by protein kinase C and becomes rate-limiting for glioma invasion.
19752303 2009 Diagnosis of neuromyelitis spectrum disorders: comparative sensitivities and specificities of immunohistochemical and immunoprecipitation assays.
19487655 2009 A case of NMO seropositive for aquaporin-4 antibody more than 10 years before onset.
19465451 2009 Aquaporin-4 autoimmune syndrome and anti-aquaporin-4 antibody-negative opticospinal multiple sclerosis in Japanese.
19445480 2009 Roles of aquaporin-4 isoforms and amino acids in square array assembly.
19383790 2009 Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.
19366470 A role for aquaporin-4 in fluid regulation in the inner retina.
19266146 2009 Narcolepsy as an initial manifestation of neuromyelitis optica with anti-aquaporin-4 antibody.
19209385 2009 Investigating the genetic role of aquaporin4 gene in migraine.
19153045 2009 Aquaporin-4 expression is increased in edematous meningiomas.
19140826 2009 Association of the HLA-DPB1*0501 allele with anti-aquaporin-4 antibody positivity in Japanese patients with idiopathic central nervous system demyelinating disorders.
19112001 2009 Differential expression of aquaporin-4 in human gastric normal and cancer tissues.
19028829 2009 Hypercomplementemia at relapse in patients with anti-aquaporin-4 antibody.
19000426 2008 [The relationship between the aquaporin-4 and brain edema, pathologic change, ultrastructure in peri-hematoma tissue in patients with intracerebral hemorrhage].
18854171 2008 Phosphorylation in the C-terminal domain of Aquaporin-4 is required for Golgi transition in primary cultured astrocytes.
18836575 2008 Changes in ocular aquaporin-4 (AQP4) expression following retinal injury.
18762715 2008 Functional characterization of human aquaporin 9 as a facilitative glycerol carrier.
18641458 2008 Aquaporin-4 expression is severely reduced in human sarcoglycanopathies and dysferlinopathies.
18516975 2008 [Neuromyelitis optica and anti-aquaporin 4 antibody--an overview].
18511455 2008 Novel variants in human Aquaporin-4 reduce cellular water permeability.
18510734 2008 Neuromyelitis optica pathogenesis and aquaporin 4.
18501347 2008 Functional characterization of a human aquaporin 0 mutation that leads to a congenital dominant lens cataract.
18474738 2008 Aquaporin-4 autoantibodies in a paraneoplastic context.
18462810 2008 Neuromyelitis optica and anti-aquaporin-4 antibodies measured by an enzyme-linked immunosorbent assay.
18437047 2008 Clinical features of opticospinal multiple sclerosis with anti-aquaporin 4 antibody.
18435417 2008 Expression of astrocytic markers aquaporin 4 and connexin 43 is altered in brains of subjects with autism.
18392839 2008 Changes in skeletal muscle expression of AQP1 and AQP4 in dystrophinopathy and dysferlinopathy patients.
18309154 2008 The role of aquaporin-4 polymorphisms in the development of brain edema after middle cerebral artery occlusion.
18280225 2008 Upregulation of AQP3 and AQP5 induced by dexamethasone and ambroxol in A549 cells.
18202181 2008 Mechanism of selectivity in aquaporins and aquaglyceroporins.
18095136 2007 Expression of aquaporine-4 in central nervous system tumors.
18071147 2007 Aquaporin-4, homeostasis, and neurologic disease.
18019416 Down-regulation of aquaporin 4 in human placenta throughout pregnancy.
17984171 2008 Genomic and functional profiling of human Down syndrome neural progenitors implicates S100B and aquaporin 4 in cell injury.
17899684 2007 Enhanced Aquaporin-4 immunoreactivity in sporadic Creutzfeldt-Jakob disease.
17890008 2007 Can variation in aquaporin 4 gene be associated with different outcomes in traumatic brain edema?
17645239 2007 Human astrocytes express aquaporin-1 and aquaporin-4 in vitro and in vivo.
17549682 2007 Expression and function of water channels (aquaporins) in migrating malignant astrocytes.
17335082 2007 Expression pattern of the water channel aquaporin-4 in human gliomas is associated with blood-brain barrier disturbance but not with patient survival.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178220 2007 Identification of arylsulfonamides as Aquaporin 4 inhibitors.
16871401 2006 Increased expression of water channel aquaporin 1 and aquaporin 4 in Creutzfeldt-Jakob disease and in bovine spongiform encephalopathy-infected bovine-PrP transgenic mice.
16831965 2006 Neuromyelitis optica brain lesions localized at sites of high aquaporin 4 expression.
16814974 2006 Fetal development of membrane water channel proteins aquaporin-1 and aquaporin-4 in the human brain.
16778375 2006 Loss of aquaporin-4 in active perivascular lesions in neuromyelitis optica: a case report.
16596446 2005 Roles of aquaporin-3 water channels in volume-regulatory water flow in a human epithelial cell line.
16194264 2005 Linkage disequilibrium in aquaporin 4 gene and association study with schizophrenia.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16133546 2005 Enhanced expression of aquaporin 4 in human brain with inflammatory diseases.
16103109 2005 New possible roles for aquaporin-4 in astrocytes: cell cytoskeleton and functional relationship with connexin43.
15948717 2006 Purification and functional characterization of aquaporin-8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15200272 2004 Reduced expression of aquaporin 4 in human muscles with amyotrophic lateral sclerosis and other neurogenic atrophies.
14753493 2003 Aquaporin 1 and aquaporin 4 expression in human brain after subarachnoid hemorrhage and in peritumoral tissue.
14701836 2004 Aquaporin-1, nothing but a water channel.
14627352 2003 Partitioning of aquaporin-4 water channel mRNA and protein in gastric glands.
12715185 2003 Enhanced expression of aquaporin 4 in human brain with infarction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12137754 2002 Positive and negative regulation of water channel aquaporins in human small intestine by cholera toxin.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
12084581 2002 Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin.
11890849 2002 Reduced aquaporin 4 expression in the muscle plasma membrane of patients with Duchenne muscular dystrophy.
11742978 2001 Polarized trafficking and surface expression of the AQP4 water channel are coordinated by serial and regulated interactions with different clathrin-adaptor complexes.
11726686 2001 Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs.
11717465 2001 Syntrophin-dependent expression and localization of Aquaporin-4 water channel protein.
11573934 2001 Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum.
11408278 2001 Identification and localization of aquaporin water channels in human salivary glands.
11245621 2001 Expression and localization of epithelial aquaporins in the adult human lung.
11076974 2000 The subcellular localization of an aquaporin-2 tetramer depends on the stoichiometry of phosphorylated and nonphosphorylated monomers.
11034202 2000 Structural determinants of water permeation through aquaporin-1.
11001937 2000 Functional impairment of lens aquaporin in two families with dominantly inherited cataracts.
10564231 1999 Functional and molecular characterization of the human neutral solute channel aquaporin-9.
10510269 1999 Functional characterization and localization of AQP3 in the human colon.
9829975 1998 Bidirectional water fluxes and specificity for small hydrophilic molecules in aquaporins 0-5.
9824541 1998 Aquaporins (water channels): role in vasopressin-activated water transport.
9806845 1998 Cloning and functional expression of human aquaporin8 cDNA and analysis of its gene.
9676432 1998 Isolation and functional analysis of alternative promoters in the human aquaporin-4 water channel gene.
9405233 1997 Molecular cloning and expression of a novel human aquaporin from adipose tissue with glycerol permeability.
9369468 1997 Mercury-sensitive residues and pore site in AQP3 water channel.
8855281 1996 The human AQP4 gene: definition of the locus encoding two water channel polypeptides in brain.
8617713 1996 The mercurial insensitive water channel (AQP-4) forms orthogonal arrays in stably transfected Chinese hamster ovary cells.
8601457 1996 A water channel closely related to rat brain aquaporin 4 is expressed in acid- and pepsinogen-secretory cells of human stomach.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7559426 1995 cDNA cloning, gene organization, and chromosomal localization of a human mercurial insensitive water channel. Evidence for distinct transcriptional units.
7530250 1995 Molecular cloning and characterization of an aquaporin cDNA from salivary, lacrimal, and respiratory tissues.
7528931 1994 Molecular characterization of an aquaporin cDNA from brain: candidate osmoreceptor and regulator of water balance.
1510932 1992 Reconstitution of functional water channels in liposomes containing purified red cell CHIP28 protein.
1373524 1992 Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.