Property Summary

NCBI Gene PubMed Count 135
PubMed Score 362.64
PubTator Score 202.13

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

Gene RIF (101)

PMID Text
26896765 these findings suggest that AQP3 is required for EGF-EGFR cell signaling in cancer cells and is a therapeutic target for cancer progression.
26830227 results demonstrate that AQP3 is required for CXCL12-induced breast cancer cell signaling and directional migration by a mechanism involving the CXCL12-induced generation of extracellular H2O2 and subsequent intracellular transport by AQP3
26810286 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion.
26786101 Based on a comparative mutagenic analysis of AQP1, AQP 3, and AQP 4, the results suggest that loop D interactions may provide a general structural framework for tetrameric assembly within the AQP family.
26765123 AQP3 knockdown retards the growth of NSCLC cells partially through inhibiting HIF-1alpha/VEGF and Raf/MEK/ERK signalling pathways.
26568619 AQP3 was expressed in trophoblast explants. Blocking it with CuSO4 prevented apoptosis.
26506416 AQP3 was found to be expressed in 67.71% of parts with GIM, and AQP3 immunoreactivity was identified more frequently in severe GIM areas (P < 0.001). In short, the incidence and severity of GIM correlated with the distance from GC, and AQP3 was differentially expressed in goblet cells, with most AQP3-positive goblet cells presenting in severe GIM.
26454884 treatment of human HepG2 cells with TCDD also increased the expression of AQP3 mRNA and protein
26313002 the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells.
26261083 The study demonstrated the abnormal expression pattern of AQP1, AQP2, AQP3, and AQP4 in the kidney tissues of patients with nephrotic syndrome, providing a basis for an improved understanding of the role of aquaporins in the pathogenesis of this disease.
26219409 We, for the first time, identified an ERE in the promoter of AQP3 gene, and found that estrogen might promote breast cancer development through activating ERE in the promoter of AQP3 gene and upregulating AQP3 expression in ER-positive breast cancer.
26107428 AQP3 may play a role in nonmelanoma skin cancer pathogenesis
26100668 AQP3-facilitated H2O2 transport is required for NF-kappaB activation in keratinocytes in the development of psoriasis.
25964557 AQP3 expression in tumor tissue may be considered as a potential prognostic marker in patients with HER2-over-expressing EBC after curative surgery.
25961543 AQP3 protein expression is regulated by cAMP-PKA-CREB signal pathway.
25914463 Report down-regulation of aquaporin3 expression by lipopolysaccharide via p38/c-Jun N-terminal kinase signalling pathway in HT-29 human colon epithelial cells.
25766885 The results suggest that morphine increases the AQP3 expression level in the colon, which promotes water absorption from the luminal side to the vascular side and causes constipation.
25721378 Study found a significant correlation between AQP1, AQP3, and AQP5 overexpression and lymph node metastasis in patients with surgically resected colon cancer.
25603981 AQP-3 expression is increased in the burn wound following injury.
25515250 AQP3 induces ERK1/2 activation, thereby increasing MMP3 expression and secretion, which in turn promotes prostate cancer cell motility and invasion.
25450461 The opening of ClC-3 transports Cl(-) across the cell membrane and then drives the efflux of water through AQP-3 channels and ion channels; AQP-3 may interact with ClC-3 in order to regulate the effluxes of chloride and water.
25299207 the reduction of aquaporins 1 and 3 may be a factor resulting in lumbar intervertebral disc degeneration.
25105540 Oleic acid-induced hepatic steatosis in HepG2 cells is associated with the coordinated regulation of aquaporin 3 and aquaporin 9 via activation of p38 signaling
24918928 Aquaporin 1 and 3 were upregulated in cervical cancer compared to mild cervicitis and cervical intraepithelial neoplasia 2-3 (P<0.05).
24887009 AQP3 promotes epithelial-mesenchymal transition in human cases of gastric adenocarcinoma.
24726500 Resveratrol inhibited NHEK proliferation by downregulating the expression of AQP3 in an SIRT1/ARNT/ERK dependent fashion.
24508472 Investigated both AQP3 expression in the skin of an experimental burn model. Observations suggest that dermal AQP3 gene expression was increased to maintain water homeostasis in response to dehydration from burn.
24488947 Enhanced water and cryoprotectant permeability of porcine oocytes after artificial expression of human and zebrafish aquaporin-3 channels.
24452376 AQP3-EGFP diffusion is altered upon increased cAMP, which may correspond to basolateral adaptations in response to the increased apical water readsorption.
24418925 analysis of the molecular link between the circadian clock and AQP3 function in mouse dorsal skin and HaCaT cells
24338365 We conclude that water fluxes accompanying CFTR activity are linked to AQP3 but not to a cAMP-stimulated aqueous pore in the CFTR protein
24260356 AQP3-Notch1 axis may provide insight into epidermal homeostasis control.
24224160 Our data suggest for the first time that the aberrant expression of AQP3 and AQP5 proteins may be strongly related to tumor progression and prognosis in patients with hepatocellular carcinoma
24022233 There is a correlation between AQP3 protein expression and tumour stage and grade in urothelial cancer, with AQP3 expression being reduced or lost in tumours of higher grade and stage.
23974882 The data suggest that the increased expression of AQP1 and AQP3 in pterygial tissues may be involved in the pathogenesis of pterygia
23800944 results provide a mechanism by which AQP3 is upregulated, as well as highlight the importance of miR-874 in gastric cancer development and progression.
23797770 High expression of both AQP3 and AQP5, not each alone, is an independent poor prognostic factor in ESCC patients.
23463292 AQP3 is an endogenous suppressor of cell apoptosis in skin fibroblasts through up-regulation of Bcl-2.
23165320 our results suggest AQP3 overexpression in human colorectal carcinoma cells could facilitate cell migration.
23152856 The present study found that AQP3 expression correlated with H. pylori infection status in gastric cancer tissues
23043286 Data suggest that assessment of aquaporin (AQP) 3 protein expression could be used to help stratify the behavior of patients with pT1 urothelial bladder cancer.
23041062 TGF-beta1 induces AQP3 and that AQP3 has a critical role in TGF-beta-induced human peritoneal mesothelial cell migration.
23017148 Data suggget that the aquaglyceroporin AQP3 is required for cytotoxic activity of 5'-DFUR and gemcitabine in the breast cancer cell line MCF7 and the colon adenocarcinoma cell line HT29.
22901156 AQP3 expression significantly increased in advanced stage of cervical cancer, deeper infiltration, metastatic lymph nodes and larger tumor volume.
22814259 AQP3 expression was closely correlated with microvascular density in NSCLC
22808259 The differential expressions of AQP3 and AQP4 may reflect the biological nature and/or function of normal, hyperplastic, and neoplastic thyroid cells and additionally may have value in determining differential diagnoses of thyroid tumors.
22624030 Potent inhibition of aquaglyceroporin-3 by a gold-based compound, through the ability of Au(III) to interact with the sulphydryl groups of proteins.
22576684 Overexpression of both AQP5 and AQP3 were immunohistochemically observed on tumor cells in squamous cell carcinoma
22535323 AQP3 is transcriptionally activated in retinal pigment epithelial (RPE) cells by various pathogenic factors involved in the development of retinal edema in situ.
22211241 Kanglaite inhibited UVB-induced AQP3 down-regulation of cultured human skin keratinocytes.
22197473 This is the first description of a potential role for aquaporin 3 in bladder cancer.
21907710 Data not only describe the correlation between transcellular and paracellular pathways in human intestines, but also show that targeted knockdown of aquaporin 3 might impair the intestinal barrier integrity.
21538271 AQP-1 expression is increased in colorectal carcinoma while the expression of AQP-3 is not. There is no correlation between the expression of AQP-1 and AQP-3 in CRC.
21457357 PPAR and LXR activators stimulate AQP3 expression, providing an additional mechanism by which PPAR and LXR activators regulate epidermal function.
21401805 overexpression of AQP3 was seen primary squamous cell carcinomas (SCC) such as esophageal and lingual cancers and cultured SCC cell lines; suppression of AQP3 protein or function caused cell death in SCC cell lines by inhibition of cell adhesion
21276418 REVIEW: evidence supporting a role for AQP3 in the epidermis
21252246 The marked early rise in expression of AQP2 and AQP3 suggests a role during the process leading to follicular rupture.
21237499 Expression patterns of aquaporin 1, 3, and 5 in lung cancer cells are mostly associated with cellular differentiation.
21191421 involvement of AQP3 in epidermal hyperplasia by a mechanism involving upregulated AQP3 expression and consequent enhancement of keratinocyte proliferation
21135872 aquaporin 3 is an essential membrane pathway for sperm regulatory volume decrease that balances the "trade-off" between sperm motility and cell swelling upon physiological hypotonicity
21063116 One sequence alteration, homozygous c.105G->C in aquaporin 3 was detected in 11 out of 34 patients but not in 100 control chromosomes.
21063116 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20596606 Found AQP3 is involved in wound healing in human skin keratinocytes. Trans-Zeatin pretreatment also attenuates UV-induced decreased water permeability in HaCaT cells.
20546216 AQP3 decreased with increasing age in normal human skin, normal human epidermal keratinocytes, and skin fibroblast samples.
20485009 Mucinous colorectal adenocarcinomas displayed 182 upregulated and 135 downregulated genes. The most upregulated genes included those involved in cellular differentiation and mucin metabolism (eg, AQP3).
20428189 reduced AQP3 in vitiliginous keratinocytes might be responsible for their reduced survival
20364107 The authors conclude that AQP3 plays a critical role in human epidermal growth factor (hEGF) induced cell migration and proliferation in human gastric cancer.
20141731 The gene expressions of AQP3 and AQP4 in gastric mucosa are different in patients with various degrees of spleen-stomach dampness-heat syndrome of chronic superficial gastritis.
20106632 AQP3, 4 & 5 exhibited differential expression between human gastric carcinoma & corresponding normal tissue;AQP3 & AQP5 expression were associated with lymph node metastasis & lymphovascular invasion
19913121 Observational study of gene-disease association. (HuGE Navigator)
19619514 These data indicate that TNF-alpha decreases AQP3 gene expression through p38 and ERK activation, and suggest that the decrease in AQP3 expression caused by TNF-alpha might be related to the phenotypes of skin inflammation, such as dry skin.
19545896 Alteration of aquaporin 1 and aquaporin 3 expression in fetal membranes and placenta may be important in the pathophysiology of isolated oligohydramnios.
19393693 Here the authors show that human aquaporin 3 is internalized into Plasmodium falciparum infected erythrocytes, presumably during or soon after invasion.
19184071 There is little influence of AQP3 on keratinocyte differentiation, but there is support for the proposed involvement of AQP3-facilitated cell proliferation.
18678926 differential polarity and selective targeting of AQP3 and AQP10 in the intestinal epithelial cells is influenced by amino acid signal motifs.
18601899 The trafficking of AQP3 evoked by epinephrine is mediated by protein kinase C in Caco-2 cells.
18543247 Discuss the role of AQP3 in TNF-alpha-mediated inflammation and the development of periodontitis.
18435676 Although reticulocytes are highly abundant in malarial anemia, low AQP3 expression was observed
18280225 The data suggest potential roles of AQP3 and 5 in the regulation of airway hypersecretion, perhaps ultimately providing a target for treating such diseases
18247144 The aim of this study was to use immunohistochemsitry to investigate the expression of aquaporins 1, 2 and 3 within the human intervertebral disc.
18197497 Up-regulated expression of AQP3 in ascending colon and down-regulated expression of AQP9 in descending colon are presented in patients with functional constipation as compared to patients without functional constipation.
18036046 The results suggest that water-channel protein may be involved in the preservation of cellular character in the human prostate and prostate cancer is associated with an alteration of water-transporting mechanisms.
17968524 Provide evidence for involvement of AQP3-facilitated water transport in epidermal cell migration and for AQP3-facilitated glycerol transport in epidermal cell proliferation.
17943189 all trans retinoic acid increased AQP3 expression and enhanced biological activity in human skin
17545093 Data show that AQP-1, 3, 8, 9 mRNA expression was detected in both amnion and chorion and can be associated with intramembranous transport and volume regulation of amniotic fluid.
17471492 results suggest that Foxa2 is one of the transcriptional regulators for AQP3 gene expression regulated by insulin
17056099 Lung carcinomas, especially adenocarcinomas, can produce AQP3, possibly in connection with their functional and/or biological nature.
16918518 Increased expression and altered cellular distribution of AQP3 is found in atopic eczema, and this may contribute to water loss.
16672223 lower expression of AQP3 and enhanced expression of MRP2 are responsible for lower arsenic accumulation in arsenic-resistant cells
16638588 provides evidence of AQP3 expression in human fetal membranes and demonstrates that AQP3 expression in primary human amnion cell culture is up-regulated by second-messenger cAMP
16596446 AQP3 water channels serve as an essential pathway for volume-regulatory water transport in human epithelial cells.
16043462 analysis of AQP3 expression in human fetal airway epithelial progenitor cells
15703994 The distribution and expression levels of AQP3 in normal human tissue.
15375592 results indicate that ANP and BNP up-regulated the expression of AQP3 mRNA and protein, and both PK-A and PK-G dependent pathways mediated this effect
14514735 reduction in the amounts of AQP-2 and AQP-3 expression, especially in lesions with substantial interstitial fibrosis and nephron loss, as compared with a healthy region of normal kidneys.
12773542 analysis of effect of nickel and extracellular acidification on water permeability of human aquaporin-3 in lung epithelial cells
12239222 first reported cases of AQP3 deficiency in humans and provide the molecular basis of a new blood group system, GIL, encoded by the AQP3 protein
12234316 Aquaporin-3 protein was detected in the human peritoneal tissue and is upregulated by glucose
11918716 the role of aquaporin-3 is to water-clamp viable layers of the epidermis in order to improve the hydration of the epidermis below the stratum corneum.
11751877 we analyzed the oligomerization of the AQP3 aquaglyceroporin, which presents a mixed selectivity for water, glycerol, and urea.

AA Sequence

MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG      1 - 70
ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP     71 - 140
NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS    141 - 210
GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN    211 - 280
VKLAHVKHKEQI                                                              281 - 292
//

Text Mined References (136)

PMID Year Title
26896765 2016 Involvement of aquaporin-3 in epidermal growth factor receptor signaling via hydrogen peroxide transport in cancer cells.
26830227 2016 Aquaporin-3 Controls Breast Cancer Cell Migration by Regulating Hydrogen Peroxide Transport and Its Downstream Cell Signaling.
26810286 2016 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in patients with otitis media with effusion.
26786101 2016 Structural Determinants of Oligomerization of the Aquaporin-4 Channel.
26765123 2016 Aquaporin-3 Inhibition Reduces the Growth of NSCLC Cells Induced by Hypoxia.
26568619 2016 Placental programmed cell death: insights into the role of aquaporins.
26506416 2015 Potential role of aquaporin 3 in gastric intestinal metaplasia.
26454884 2016 Regulation of Aquaporin 3 Expression by the AhR Pathway Is Critical to Cell Migration.
26313002 2015 Aquaporins Mediate Silicon Transport in Humans.
26261083 2015 Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema.
26219409 2015 Identification of Estrogen Response Element in Aquaporin-3 Gene that Mediates Estrogen-induced Cell Migration and Invasion in Estrogen Receptor-positive Breast Cancer.
26107428 2015 Evaluation of Aquaporin-3 Role in Nonmelanoma Skin Cancer: An Immunohistochemical Study.
26100668 2015 Aquaporin-3-mediated hydrogen peroxide transport is required for NF-?B signalling in keratinocytes and development of psoriasis.
25964557 2015 Aquaporin 3 Expression Predicts Survival in Patients with HER2-positive Early Breast Cancer.
25961543 2015 Expression of AQP3 protein in hAECs is regulated by Camp-PKA-CREB signalling pathway.
25914463 2015 Down-regulation of aquaporin3 expression by lipopolysaccharide via p38/c-Jun N-terminal kinase signalling pathway in HT-29 human colon epithelial cells.
25766885 2015 Morphine-Induced Constipation Develops With Increased Aquaporin-3 Expression in the Colon via Increased Serotonin Secretion.
25721378 2015 Expression of aquaporin-1, aquaporin-3, and aquaporin-5 correlates with nodal metastasis in colon cancer.
25603981 2015 Epidermal aquaporin-3 is increased in the cutaneous burn wound.
25515250 2015 Aquaporin 3 promotes prostate cancer cell motility and invasion via extracellular signal-regulated kinase 1/2-mediated matrix metalloproteinase-3 secretion.
25450461 2014 The AQP-3 water channel and the ClC-3 chloride channel coordinate the hypotonicity-induced swelling volume in nasopharyngeal carcinoma cells.
25299207 2014 Expression of aquaporins 1 and 3 in degenerative tissue of the lumbar intervertebral disc.
25105540 2015 Oleic acid-induced hepatic steatosis is coupled with downregulation of aquaporin 3 and upregulation of aquaporin 9 via activation of p38 signaling.
24918928 2014 Expression and prognostic value of aquaporin 1, 3 in cervical carcinoma in women of Uygur ethnicity from Xinjiang, China.
24887009 2014 Aquaporin 3 promotes epithelial-mesenchymal transition in gastric cancer.
24726500 2014 Resveratrol inhibition of human keratinocyte proliferation via SIRT1/ARNT/ERK dependent downregulation of aquaporin 3.
24508472 2014 Forensic diagnosis of ante- and postmortem burn based on aquaporin-3 gene expression in the skin.
24488947 2014 Enhanced water and cryoprotectant permeability of porcine oocytes after artificial expression of human and zebrafish aquaporin-3 channels.
24452376 2014 Elevated cAMP increases aquaporin-3 plasma membrane diffusion.
24418925 2014 24-hour rhythm of aquaporin-3 function in the epidermis is regulated by molecular clocks.
24338365 2014 The human CFTR protein expressed in CHO cells activates aquaporin-3 in a cAMP-dependent pathway: study by digital holographic microscopy.
24260356 2013 An aquaporin 3-notch1 axis in keratinocyte differentiation and inflammation.
24224160 2013 Prognostic value of combined aquaporin 3 and aquaporin 5 overexpression in hepatocellular carcinoma.
24022233 2014 Expression of aquaporin water channels in human urothelial carcinoma: correlation of AQP3 expression with tumour grade and stage.
23974882 2013 Increased Expression of Aquaporin-1 and Aquaporin-3 in Pterygium.
23800944 2014 miR-874 Inhibits cell proliferation, migration and invasion through targeting aquaporin-3 in gastric cancer.
23797770 2013 Co-expression of AQP3 and AQP5 in esophageal squamous cell carcinoma correlates with aggressive tumor progression and poor prognosis.
23463292 2013 Protective role of AQP3 in UVA-induced NHSFs apoptosis via Bcl2 up-regulation.
23165320 2013 Critical role of aquaporin-3 in epidermal growth factor-induced migration of colorectal carcinoma cells and its clinical significance.
23152856 2012 Involvement of Aquaporin 3 in Helicobacter pylori-related gastric diseases.
23043286 2012 Loss of aquaporin 3 protein expression constitutes an independent prognostic factor for progression-free survival: an immunohistochemical study on stage pT1 urothelial bladder cancer.
23041062 2012 Aquaporin 3 expression is up-regulated by TGF-?1 in rat peritoneal mesothelial cells and plays a role in wound healing.
23017148 2012 Aquaporin 3 (AQP3) participates in the cytotoxic response to nucleoside-derived drugs.
22901156 2012 Significance and expression of aquaporin 1, 3, 8 in cervical carcinoma in Xinjiang Uygur women of China.
22814259 2012 [Correlation of aquaporin 3 expression with the clinicopathologic characteristics of non-small cell lung cancer].
22808259 2012 Differential expression of aquaporins and its diagnostic utility in thyroid cancer.
22624030 2012 Targeting aquaporin function: potent inhibition of aquaglyceroporin-3 by a gold-based compound.
22576684 2012 Differential expression of aquaporin 5 and aquaporin 3 in squamous cell carcinoma and adenoid cystic carcinoma.
22535323 2012 Transcriptional regulation of aquaporin-3 in human retinal pigment epithelial cells.
22211241 2012 Kanglaite attenuates UVB-induced down-regulation of aquaporin-3 in cultured human skin keratinocytes.
22197473 2012 Aquaporin 3 protein expression in transitional cell carcinoma: a potential marker with regard to tumour progression and prognosis?
21907710 2011 Knockdown of aquaporin 3 is involved in intestinal barrier integrity impairment.
21538271 2011 [Significance of aquaporin-1 and aquaporin-3 expression in colorectal carcinoma].
21457357 2011 PPARgamma activators stimulate aquaporin 3 expression in keratinocytes/epidermis.
21401805 2011 Critical role of aquaporin 3 on growth of human esophageal and oral squamous cell carcinoma.
21276418 2011 Aquaporin-3 in keratinocytes and skin: its role and interaction with phospholipase D2.
21252246 2011 The water permeability channels aquaporins 1-4 are differentially expressed in granulosa and theca cells of the preovulatory follicle during precise stages of human ovulation.
21251984 2011 Water permeability and characterization of aquaporin-11.
21237499 2011 Relationship of aquaporin 1, 3, and 5 expression in lung cancer cells to cellular differentiation, invasive growth, and metastasis potential.
21191421 2011 Upregulation of aquaporin-3 is involved in keratinocyte proliferation and epidermal hyperplasia.
21135872 2011 Aquaporin3 is a sperm water channel essential for postcopulatory sperm osmoadaptation and migration.
21063116 2010 Molecular analysis of aquaporin genes 1 to 4 in patients with Menière's disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20596606 2010 Trans-Zeatin attenuates ultraviolet induced down-regulation of aquaporin-3 in cultured human skin keratinocytes.
20546216 2010 Aquaporin-3 gene and protein expression in sun-protected human skin decreases with skin ageing.
20485009 2010 Gene expression profiling of colorectal mucinous adenocarcinomas.
20428189 2010 Reduced aquaporin3 expression and survival of keratinocytes in the depigmented epidermis of vitiligo.
20364107 2010 Critical role of aquaporin-3 in the human epidermal growth factor-induced migration and proliferation in the human gastric adenocarcinoma cells.
20141731 2010 Relationship between gene expressions of aquaporin 3 and 4 and various degrees of spleen-stomach dampness-heat syndrome in chronic superficial gastritis.
20106632 2010 Expression profile of multiple aquaporins in human gastric carcinoma and its clinical significance.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19619514 2009 Tumor necrosis factor-alpha decreases aquaporin-3 expression in DJM-1 keratinocytes.
19545896 2009 Expression of aquaporin 1 and aquaporin 3 in fetal membranes and placenta in human term pregnancies with oligohydramnios.
19393693 2009 Recruitment of human aquaporin 3 to internal membranes in the Plasmodium falciparum infected erythrocyte.
19184071 2009 The expression of differentiation markers in aquaporin-3 deficient epidermis.
18762715 2008 Functional characterization of human aquaporin 9 as a facilitative glycerol carrier.
18718702 2009 Expression and localisation of aquaporin water channels in human urothelium in situ and in vitro.
18678926 2008 Compartmentalization of aquaporins in the human intestine.
18601899 2008 Membrane trafficking of aquaporin 3 induced by epinephrine.
18543247 2008 The role of water channel aquaporin 3 in the mechanism of TNF-alpha-mediated proinflammatory events: Implication in periodontal inflammation.
18511455 2008 Novel variants in human Aquaporin-4 reduce cellular water permeability.
18501347 2008 Functional characterization of a human aquaporin 0 mutation that leads to a congenital dominant lens cataract.
18495115 2008 Regulation of aquaporin 3 expression by magnesium ion.
18435676 2008 Genetic conservation of the GIL blood group determining aquaporin 3 gene in African and Caucasian populations.
18280225 2008 Upregulation of AQP3 and AQP5 induced by dexamethasone and ambroxol in A549 cells.
18247144 2008 Aquaporin expression in the human intervertebral disc.
18202181 2008 Mechanism of selectivity in aquaporins and aquaglyceroporins.
18197497 2008 [Expression and significance of aquaporin 3 and aquaporin 9 in colonic mucosa of patients with functional constipation].
18036046 2007 Expression of aquaporin 3 in the human prostate.
17968524 2008 Aquaporin-3 facilitates epidermal cell migration and proliferation during wound healing.
17943189 2008 Retinoic acid increases aquaporin 3 expression in normal human skin.
17545093 2007 [Expression of aquaporins 1, 3, 8, 9 mRNA in human fetal membranes].
17471492 2007 Transcriptional regulation of aquaporin 3 by insulin.
17178220 2007 Identification of arylsulfonamides as Aquaporin 4 inhibitors.
17056099 2007 Expression of aquaporin 3 (AQP3) in normal and neoplastic lung tissues.
16918518 2006 Increased expression of aquaporin 3 in atopic eczema.
16672223 2006 Enhanced expression of multidrug resistance-associated protein 2 and reduced expression of aquaglyceroporin 3 in an arsenic-resistant human cell line.
16638588 2006 Aquaporin 3 expression in human fetal membranes and its up-regulation by cyclic adenosine monophosphate in amnion epithelial cell culture.
16596446 2005 Roles of aquaporin-3 water channels in volume-regulatory water flow in a human epithelial cell line.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16043462 2005 Aquaporin-3 expression in human fetal airway epithelial progenitor cells.
15948717 2006 Purification and functional characterization of aquaporin-8.
15703994 2005 Distribution of AQP2 and AQP3 water channels in human tissue microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375592 2004 Natriuretic peptides up-regulate aquaporin 3 in a human colonic epithelial cell line.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701836 2004 Aquaporin-1, nothing but a water channel.
14675200 2003 Aquaporin 3 colocates with phospholipase d2 in caveolin-rich membrane microdomains and is downregulated upon keratinocyte differentiation.
14521551 AQP1 and AQP3, psoriasin, and nitric oxide synthases 1-3 are inflammatory mediators in erythema toxicum neonatorum.
14514735 2003 Aquaporin expression in normal human kidney and in renal disease.
12773542 2003 Nickel and extracellular acidification inhibit the water permeability of human aquaporin-3 in lung epithelial cells.
12769265 Expression of aquaporin 3 and its localization in normal skeletal myofibres.
12522663 2003 Aquaporin expression in developing human teeth and selected orofacial tissues.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239222 2002 AQP3 deficiency in humans and the molecular basis of a novel blood group system, GIL.
12234316 2002 Expression of aquaporin-3 in human peritoneal mesothelial cells and its up-regulation by glucose in vitro.
12084581 2002 Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin.
11573934 2001 Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum.
11076974 2000 The subcellular localization of an aquaporin-2 tetramer depends on the stoichiometry of phosphorylated and nonphosphorylated monomers.
11034202 2000 Structural determinants of water permeation through aquaporin-1.
11001937 2000 Functional impairment of lens aquaporin in two families with dominantly inherited cataracts.
10564231 1999 Functional and molecular characterization of the human neutral solute channel aquaporin-9.
10510269 1999 Functional characterization and localization of AQP3 in the human colon.
9829975 1998 Bidirectional water fluxes and specificity for small hydrophilic molecules in aquaporins 0-5.
9806845 1998 Cloning and functional expression of human aquaporin8 cDNA and analysis of its gene.
9558461 1998 Aquaporin-2 and -3: representatives of two subgroups of the aquaporin family colocalized in the kidney collecting duct.
9525951 1998 Evidence for the presence of aquaporin-3 in human red blood cells.
9405233 1997 Molecular cloning and expression of a novel human aquaporin from adipose tissue with glycerol permeability.
9369468 1997 Mercury-sensitive residues and pore site in AQP3 water channel.
8641135 1996 Localization of the human gene for aquaporin 3 (AQP3) to chromosome 9, region p21-->p12, using fluorescent in situ hybridization.
7558005 1995 Structure and chromosomal localization of a human water channel (AQP3) gene.
7543093 1995 Isolation of human aquaporin 3 gene.
7530250 1995 Molecular cloning and characterization of an aquaporin cDNA from salivary, lacrimal, and respiratory tissues.
1510932 1992 Reconstitution of functional water channels in liposomes containing purified red cell CHIP28 protein.
1373524 1992 Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.