Property Summary

NCBI Gene PubMed Count 1
PubMed Score 10.85
PubTator Score 0.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 1.9

Expression

AA Sequence

MAGLNVSLSFFFATFTLCEAARRASKALLPVGAYEVFAREAMRTLVELGPWAGDFGPDLLLTLLFLLFLA      1 - 70
HGVTLDGASANPTVSLQEFLMAEESLPGTLLKLAAQGLGMQAACTLTRLCWAWELSDLHLLQSLMAQSCS     71 - 140
SALRTSVPHGALVEAACAFCFHLTLLHLRHSPPAYSGPAVALLVTVTAYTAGPFTSAFFNPALAASVTFA    141 - 210
CSGHTLLEYVQVYWLGPLTGMVLAVLLHQGRLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSS    211 - 280
VREPGRSGVEGPHSS                                                           281 - 295
//

Text Mined References (3)

PMID Year Title