Property Summary

NCBI Gene PubMed Count 39
PubMed Score 14.48
PubTator Score 18.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pancreatic cancer 2300 5.9e-04
pancreatic carcinoma 567 5.9e-04
Disease Target Count Z-score Confidence
Pompholyx 4 4.484 2.2
Intestinal tuberculosis 5 3.937 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic cancer 1.200 5.9e-04
pancreatic carcinoma 1.200 5.9e-04

Gene RIF (13)

PMID Text
26810286 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in middle ear effusion is associated with the pathophysiology of otitis media with effusion.
26313002 the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells.
23382902 Aquaporin-10 is expressed exclusively in the adipocytes, which is particularly important for the maintenance of normal or low glycerol contents inside the adipocyte, thus protecting humans from obesity.
21733844 the presence of at least one glycosylated protein within each tetramer is sufficient to convey an enhanced structural stability to the remaining hAQP10 protomers of the tetramer.
21691092 study unveiled the uniquely dual functional characteristic of hAQP10 as a carrier/channel for solute transport, providing a novel insight into its operation mechanism, which would help further elucidate its physiological role
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18678926 differential polarity and selective targeting of AQP3 and AQP10 in the intestinal epithelial cells is influenced by amino acid signal motifs.
17975119 Observational study of gene-disease association. (HuGE Navigator)
15898950 AQP10 with an insertion of 475 nt was localized in the capillary endothelium in villi of the small intestine and the isoform without the insertion localized in the gastro-entero-pancrestic endocrine cells.
12084581 Results suggest that AQP10 represents a new member of aquaglyceroporins functionally as well as structurally.

AA Sequence

MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAI      1 - 70
YVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPK     71 - 140
ETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCG    141 - 210
IPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVS    211 - 280
AQHKASELETPASAQMLECKL                                                     281 - 301
//

Text Mined References (40)

PMID Year Title
26810286 2016 Expression of CXCL4 and aquaporin 3 and 10 mRNAs in patients with otitis media with effusion.
26313002 2015 Aquaporins Mediate Silicon Transport in Humans.
23382902 2013 Aquaporin-10 represents an alternative pathway for glycerol efflux from human adipocytes.
21733844 2011 Glycosylation increases the thermostability of human aquaporin 10 protein.
21691092 2011 Dual functional characteristic of human aquaporin 10 for solute transport.
21251984 2011 Water permeability and characterization of aquaporin-11.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18762715 2008 Functional characterization of human aquaporin 9 as a facilitative glycerol carrier.
18678926 2008 Compartmentalization of aquaporins in the human intestine.
18511455 2008 Novel variants in human Aquaporin-4 reduce cellular water permeability.
18501347 2008 Functional characterization of a human aquaporin 0 mutation that leads to a congenital dominant lens cataract.
18202181 2008 Mechanism of selectivity in aquaporins and aquaglyceroporins.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17575980 2007 Differential expression of intestinal membrane transporters in cholera patients.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17178220 2007 Identification of arylsulfonamides as Aquaporin 4 inhibitors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16596446 2005 Roles of aquaporin-3 water channels in volume-regulatory water flow in a human epithelial cell line.
15948717 2006 Purification and functional characterization of aquaporin-8.
15898950 2005 Expression and localization of two isoforms of AQP10 in human small intestine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14701836 2004 Aquaporin-1, nothing but a water channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12084581 2002 Cloning and identification of a new member of water channel (AQP10) as an aquaglyceroporin.
11573934 2001 Cloning of a new aquaporin (AQP10) abundantly expressed in duodenum and jejunum.
11076974 2000 The subcellular localization of an aquaporin-2 tetramer depends on the stoichiometry of phosphorylated and nonphosphorylated monomers.
11034202 2000 Structural determinants of water permeation through aquaporin-1.
11001937 2000 Functional impairment of lens aquaporin in two families with dominantly inherited cataracts.
10564231 1999 Functional and molecular characterization of the human neutral solute channel aquaporin-9.
10510269 1999 Functional characterization and localization of AQP3 in the human colon.
9829975 1998 Bidirectional water fluxes and specificity for small hydrophilic molecules in aquaporins 0-5.
9806845 1998 Cloning and functional expression of human aquaporin8 cDNA and analysis of its gene.
9405233 1997 Molecular cloning and expression of a novel human aquaporin from adipose tissue with glycerol permeability.
9369468 1997 Mercury-sensitive residues and pore site in AQP3 water channel.
7530250 1995 Molecular cloning and characterization of an aquaporin cDNA from salivary, lacrimal, and respiratory tissues.
1510932 1992 Reconstitution of functional water channels in liposomes containing purified red cell CHIP28 protein.
1373524 1992 Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.