Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.93
PubTator Score 22.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 2.0e-09
osteosarcoma 1.217 5.0e-04
atypical teratoid / rhabdoid tumor -1.100 1.2e-04
glioblastoma -1.300 2.9e-03
medulloblastoma, large-cell -1.600 3.1e-04
ulcerative colitis -1.051 2.3e-02
tuberculosis -1.700 1.1e-06
lung cancer -2.400 7.0e-03
ovarian cancer -1.800 4.4e-06

 GO Function (1)

Gene RIF (2)

PMID Text
25194880 It facilitates the regulator of calcineurin 1-mediated apoptosis by downregulating proteasome subunits.
12915535 Association of the herpes simplex virus type 1 Us11 gene product with the cellular kinesin light-chain-related protein PAT1 results in the redistribution of both polypeptides.

AA Sequence

MAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEFCELEVFAKVL      1 - 70
RALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAIQVGFVLGGFLSDAGWYSDAE     71 - 140
KVFLSCLQLCTLHDEMLHWFRAVECCVRLLHVRNGNCKYHLGEETFKLAQTYMDKLSKHGQQANKAALYG    141 - 210
ELCALLFAKSHYDEAYKWCIEAMKEITAGLPVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHF    211 - 280
GSKHPKYSDTLLDYGFYLLNVDNICQSVAIYQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKF    281 - 350
DNALFHAERAIGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKA    351 - 420
FGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYEN    421 - 490
AEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDV    491 - 560
STSPQSTEEVVQSFLISQNVEGPSC                                                 561 - 585
//

Text Mined References (17)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25194880 2015 Amyloid-? precursor protein facilitates the regulator of calcineurin 1-mediated apoptosis by downregulating proteasome subunit ? type-5 and proteasome subunit ? type-7.
21118134 2010 Pat1 proteins: a life in translation, translation repression and mRNA decay.
19570594 2011 PAT1 induces cell death signal and SET mislocalization into the cytoplasm by increasing APP/APLP2 at the cell surface.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12915535 2003 Association of the herpes simplex virus type 1 Us11 gene product with the cellular kinesin light-chain-related protein PAT1 results in the redistribution of both polypeptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11742091 2001 The gamma -secretase-cleaved C-terminal fragment of amyloid precursor protein mediates signaling to the nucleus.
11331760 2001 Comprehensive copy number and gene expression profiling of the 17q23 amplicon in human breast cancer.
11034067 2000 Multiple genes at 17q23 undergo amplification and overexpression in breast cancer.
9843960 1998 PAT1, a microtubule-interacting protein, recognizes the basolateral sorting signal of amyloid precursor protein.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.