Property Summary

NCBI Gene PubMed Count 10
PubMed Score 36.00
PubTator Score 4.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.100 2.6e-03

Synonym

Accession Q96IL0 Q53G28 APOP-1
Symbols APOP
APOP1
C14orf153

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MLPCAAGARGRGAMVVLRAGKKTFLPPLCRAFACRGCQLAPERGAERRDTAPSGVSRFCPPRKSCHDWIG      1 - 70
PPDKYSNLRPVHFYIPENESPLEQKLRKLRQETQEWNQQFWANQNLTFSKEKEEFIHSRLKTKGLGLRTE     71 - 140
SGQKATLNAEEMADFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN        141 - 206
//

Text Mined References (11)

PMID Year Title