Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.48
PubTator Score 2.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 7.1e-05
astrocytic glioma -1.300 2.1e-03
ependymoma -1.500 3.6e-03
oligodendroglioma -1.100 4.0e-03
osteosarcoma -1.130 4.2e-02
pancreatic ductal adenocarcinoma liver m... -1.148 1.4e-02
non-small cell lung cancer 1.017 4.3e-12
lung cancer 2.100 7.9e-05
aldosterone-producing adenoma -1.227 1.9e-02
ovarian cancer 1.100 1.1e-02

 GO Process (1)

Gene RIF (1)

PMID Text
23704930 APOOL is a cardiolipin-binding component of the Mitofilin/MINOS protein complex.

AA Sequence

MAAIRMGKLTTMPAGLIYASVSVHAAKQEESKKQLVKPEQLPIYTAPPLQSKYVEEQPGHLQMGFASIRT      1 - 70
ATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKGSKFKKITY     71 - 140
PLGLATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVP    141 - 210
AKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPEDIDMYSTRS                211 - 268
//

Text Mined References (15)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25781180 2015 Detailed analysis of the human mitochondrial contact site complex indicate a hierarchy of subunits.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
24687277 2014 Uniform nomenclature for the mitochondrial contact site and cristae organizing system.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704930 2013 APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.