Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.86
PubTator Score 11.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2844 3.1e-18
lung cancer 4473 9.3e-05
Breast cancer 3098 1.2e-04
Pick disease 1893 2.5e-04
invasive ductal carcinoma 2950 3.2e-04
psoriasis 6685 1.8e-03
astrocytic glioma 2241 6.8e-03
ependymoma 2514 3.2e-02
oligodendroglioma 2849 3.2e-02

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 6.8e-03
ependymoma -1.100 3.2e-02
oligodendroglioma -1.100 3.2e-02
psoriasis -1.100 1.8e-03
lung cancer 3.100 9.3e-05
lung carcinoma 1.500 3.1e-18
Pick disease -1.200 2.5e-04
invasive ductal carcinoma 1.200 3.2e-04
Breast cancer 1.100 1.2e-04

Gene RIF (9)

PMID Text
25764979 The human apolipoprotein MIC26 is a bona fide subunit of the MICOS complex.
24743151 APOO represents a link between impaired mitochondrial function and cardiomyopathy onset, and targeting APOO-dependent metabolic remodeling has potential as a strategy to adjust heart metabolism and protect the myocardium from impaired contractility.
24341743 It is likely that apoO participates in fatty acid metabolism and the inflammatory response in HepG2 cells.
22693255 relationships between plasma apoO levels and high-sensitive C-reactive protein (hs-CRP) levels, as well as other lipid parameters in healthy subjects and patients with established acute coronary syndrome
20877300 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
16956892 apolipoprotein O is the first chondroitin sulfate chain containing apolipoprotein

AA Sequence

MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY      1 - 70
CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP     71 - 140
GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK                141 - 198
//

Text Mined References (20)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25781180 2015 Detailed analysis of the human mitochondrial contact site complex indicate a hierarchy of subunits.
25764979 2015 The non-glycosylated isoform of MIC26 is a constituent of the mammalian MICOS complex and promotes formation of crista junctions.
24743151 2014 Apolipoprotein O is mitochondrial and promotes lipotoxicity in heart.
24341743 2013 Microarray analysis provides new insights into the function of apolipoprotein O in HepG2 cell line.
22693255 2012 Plasma apolipoprotein O level increased in the patients with acute coronary syndrome.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21269460 2011 Initial characterization of the human central proteome.
20877300 2012 Genome-wide association study of increasing suicidal ideation during antidepressant treatment in the GENDEP project.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16956892 2006 ApoO, a novel apolipoprotein, is an original glycoprotein up-regulated by diabetes in human heart.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.