Property Summary

NCBI Gene PubMed Count 105
PubMed Score 258.45
PubTator Score 126.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.300 1.9e-14
medulloblastoma 1.200 2.7e-08
nephrosclerosis -1.676 1.8e-02
osteosarcoma -1.260 4.9e-04
pancreatic ductal adenocarcinoma liver m... -1.652 3.2e-02

Protein-protein Interaction (5)

Gene RIF (92)

AA Sequence

MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIV      1 - 70
FNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQG     71 - 140
YQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN                          141 - 188
//

Text Mined References (107)

PMID Year Title