Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.57
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 1.300 2.4e-03
osteosarcoma -2.180 1.1e-03
non-small cell lung cancer -1.489 8.3e-17
lung cancer -3.800 2.0e-05
active Crohn's disease 1.557 6.4e-03
fibroadenoma -1.100 4.0e-02
Breast cancer -3.700 2.9e-02
interstitial cystitis 1.300 1.1e-03
lung adenocarcinoma -1.557 1.1e-10
lung carcinoma -1.600 1.5e-13
ulcerative colitis 1.100 4.3e-03

Synonym

Accession O95236 B1AHI4 B1AHI5 Q5U5N4 Q9BQ82 Q9BQA3
Symbols CG121
CG12_1
APOLIII
apoL-III

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
20631155 An association between an single nucleotide polymorphisms within the APOL3 locus and prostate cancer risk, is revealed.
20631155 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
11944986 APOL3 has been found only in humans and African green monkeys

AA Sequence

MGLGQGWGWEASCFACLIRSCCQVVTFTFPFGFQGISQSLENVSGYYADARLEVGSTQLRTAGSCSHSFK      1 - 70
RSFLEKKRFTEEATKYFRERVSPVHLQILLTNNEAWKRFVTAAELPRDEADALYEALKKLRTYAAIEDEY     71 - 140
VQQKDEQFREWFLKEFPQVKRKIQESIEKLRALANGIEEVHRGCTISNVVSSSTGAASGIMSLAGLVLAP    141 - 210
FTAGTSLALTAAGVGLGAASAVTGITTSIVEHSYTSSAEAEASRLTATSIDRLKVFKEVMRDITPNLLSL    211 - 280
LNNYYEATQTIGSEIRAIRQARARARLPVTTWRISAGSGGQAERTIAGTTRAVSRGARILSATTSGIFLA    281 - 350
LDVVNLVYESKHLHEGAKSASAEELRRQAQELEENLMELTQIYQRLNPCHTH                      351 - 402
//

Text Mined References (19)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
20631155 2010 Family-based association analysis of 42 hereditary prostate cancer families identifies the Apolipoprotein L3 region on chromosome 22q12 as a risk locus.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19946888 2010 Defining the membrane proteome of NK cells.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944986 2002 The apolipoprotein L gene cluster has emerged recently in evolution and is expressed in human vascular tissue.
11930015 2002 Gene expression analysis in schizophrenia: reproducible up-regulation of several members of the apolipoprotein L family located in a high-susceptibility locus for schizophrenia on chromosome 22.
11374903 2001 The human apolipoprotein L gene cluster: identification, classification, and sites of distribution.
11290834 2001 Apolipoprotein L gene family: tissue-specific expression, splicing, promoter regions; discovery of a new gene.
10591208 1999 The DNA sequence of human chromosome 22.
10233894 1999 Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.