Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.24
PubTator Score 6.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.543 1.2e-03
active ulcerative colitis 1.311 1.8e-02
atypical teratoid / rhabdoid tumor -1.300 1.6e-05
cutaneous lupus erythematosus 1.700 2.0e-03
glioblastoma -1.500 4.1e-05
group 4 medulloblastoma -1.300 1.1e-03
lung cancer -1.100 5.4e-04
medulloblastoma, large-cell -1.400 1.5e-05
osteosarcoma -3.837 1.0e-10
ovarian cancer -1.300 1.1e-05
pediatric high grade glioma -1.200 2.3e-04
psoriasis -2.900 3.5e-05

Gene RIF (7)

AA Sequence

MNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNR      1 - 70
HDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHRGTTIANVVSNSVGTTSGILTLLGLGLAPF     71 - 140
TEGISFVLLDTGMGLGAAAAVAGITCSVVELVNKLRARAQARNLDQSGTNVAKVMKEFVGGNTPNVLTLV    141 - 210
DNWYQVTQGIGRNIRAIRRARANPQLGAYAPPPHIIGRISAEGGEQVERVVEGPAQAMSRGTMIVGAATG    211 - 280
GILLLLDVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQDQ                 281 - 337
//

Text Mined References (20)

PMID Year Title