Property Summary

NCBI Gene PubMed Count 122
PubMed Score 298.77
PubTator Score 53.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.300 6.6e-07
Barrett's esophagus 1.100 4.8e-02
esophageal adenocarcinoma 1.500 2.5e-02
psoriasis 2.600 4.4e-159
cutaneous lupus erythematosus 1.900 5.0e-03
osteosarcoma -1.133 6.9e-03
tuberculosis 1.200 4.0e-04
primary pancreatic ductal adenocarcinoma 1.382 1.1e-02
lung cancer -1.800 2.5e-05
active Crohn's disease 2.150 6.0e-03
active ulcerative colitis 2.517 1.0e-02
pancreatic cancer 1.400 9.1e-03
diabetes mellitus -1.100 2.8e-02
lung carcinoma -1.800 7.6e-21
ovarian cancer 1.400 5.8e-04

Gene RIF (114)

PMID Text
27054572 APOL1 G1 and G2 genotypes in deceased African American liver donors have minimal effects on liver transplant outcomes.
26699492 Expression of either G1 or G2 APOL1 variants increased cell swelling and death vs G0-expressing cells. This was preceded by G1 or G2 APOL1-induced net efflux of intracellular potassium, resulting in the activation of stress-activated protein kinases.
26634651 APOL1 genotype is associated with albuminuria, subclinical atherosclerosis, incident myocardial infarction, and mortality in older African Americans.
26586272 We examined whether APOL1 G1 and G2 renal-risk variant serum concentrations or lipoprotein distributions differed from nonrisk G0 APOL1 in African Americans without nephropathy.
26566060 Shorter renal allograft survival is reproducibly observed after deceased donor kidney transplantation from APOL1 2-renal-risk-variant African American donors.
26430087 Sociodemographic factors and common risk factors for chronic kidney disease progression do not seem to alter APOL1-related CKD progression.
26307671 Trypanolysis by APOL1 is linked to apoptosis-like mitochondrial membrane permabilization occurring together with TbKIFC1-mediated transport of APOL1 from endolysosomal membranes to the mitochondrion.
26180129 blacks with two APOL1 risk alleles had the highest risk for albuminuria and eGFRcys decline in young adulthood, whereas disparities between low-risk blacks and whites were related to differences in traditional risk factors.
26150607 we have shown that individuals with the high risk APOL1 genotype enrolled in the NEPTUNE study present, from a clinical and histologic perspective, with more advanced disease and have less remission of proteinuria over time.
26147622 concordant with the genetic interaction observed in sickle cell disease patients, APOL1 G2 reduces myh9 expression in vivo, suggesting a possible interaction between the altered APOL1 and myh9.
26112018 study does provide an indication that APOL1 variants may play a role in conferring an increased risk for renal and cardiovascular risk in this population.
26108665 Expression of APOL1 increased ion permeability and caused profound morphological deterioration.
26091559 Our study not only reveals the contribution of each domain of the APOL1 protein to cell injury, but also highlights some potential suggested targets for drug design to prevent or treat APOL1-associated nephropathy.
26089538 basic biology and trafficking behavior of circulating APOL1 from the liver
26038529 These findings indicate that APOL1 risk alleles are associated with exaggerated age-related nephron loss.
26025194 The relationship between HDLC and eGFR is strongly influenced by the APOL1 rs73885319 kidney risk genotype.
25993319 Only APOL1 G1 and G2 confer renal risk, and other common and rare APOL1 missense variants, including the archaic G3 haplotype, do not contribute to sporadic FSGS and HIVAN in the US population.
25933006 The presence of APOL1 duplication was observed in 4.06%of cases with kidney diseases versus 0.78% in controls, indicating that this APOL1 duplication may alter susceptibility to kidney disease in African Americans.
25924622 Identify exon 4 as a major determinant of APOL1 podocyte cytotoxicity.
25921719 Among HIV-infected African American women, APOL1-associated kidney injury appears to localize to the glomerulus, rather than the tubules.
25887069 Higher levels of factor VIIc, VIIIc, fibrinogen, vonWillebrand factor, and protein C were associated with ESRD risk, with a significantly stronger association of factor VIIIc and protein C in African Americans with two APOL1 risk alleles.
25853332 This review provides an update on the biological functions for circulating (trypanosome resistance) and intracellular (emerging role for autophagy) APOL1.
25809272 Apolipoprotein L1 gene variants in deceased organ donors are associated with renal allograft failure.
25788523 HIV-positive, antiretroviral therapy-naive South-African blacks with two APOL1 risk alleles are at very high risk for developing HIV-associated nephropathy
25730870 These data are consistent with a model of lysis that involves endocytic recycling of APOL1 and the formation of cation-selective channels, at neutral pH, in the parasite plasma membrane.
25573908 APOL1 risk genotypes did not affect response to drug therapy with patients diagnosed FSGS.
25530085 Two APOL1 risk alleles in young hypertensive African Americans with a family history of ESRD are strongly associated with kidney disease.
25349204 African ancestry was significantly was associated with the genetic susceptibility of chronic kidney diseases.
25249559 study concludes that variation in APOL1 G3 makes a nominal, if any, contribution to end-stage renal disease in African Americans; G1 and G2 variants explain the vast majority of nondiabetic nephropathy susceptibility
25168832 update on the spectrum of APOL1 kidney disease and on the worldwide distribution of these kidney risk variants[review]
25100047 interferons and the molecular pattern recognition receptors that stimulate interferon production may contribute to APOL1-associated kidney disease
25081748 These findings support involvement of multiple cell types in subnephrotic forms of APOL1-associated nephropathy, particularly renal tubule cells with resultant tubulointerstitial disease
25054777 APOL1 nephropathy variants associate with lower levels of subclinical atherosclerosis and reduced risk of death in African Americans with type 2 diabetes mellitus
25029429 APOL1 risk variants were not significantly associated with prevalent cardiovascular disease
24899058 APOL1 risk variants enhance podocyte necrosis through compromising lysosomal membrane permeability.
24808134 analysis of genetic variants of human APOL1 that protect against T. brucei rhodesiense as well as evolution of this trypanolytic factor
24731740 The presence of 2 APOL1 risk alleles confers a strong risk for the development of PLA2R-associated collapsing glomerulopathy in African Americans
24658608 APOL1 gene polymorphisms do not confer an increased risk of chronic kidney disease in lupus nephritis patients.
24518129 APOL1 genotyping revealed that both donor and recipient were heterozygous for the G1 and G2 alleles.
24504811 End-stage renal disease in African Americans with lupus nephritis is associated with APOL1.
24379297 APOL1 variants contribute to atherosclerotic CVD risk, indicating a genetic component to cardiovascular health disparities in individuals of African ancestry.
24233469 review of the biology of APOL1 present in the circulation and localized to the kidney as it may contribute to the pathogenesis of APOL1-associated kidney disease
24231663 The function of variant APOL1 proteins derived from circulation or synthesized in the kidney, but not the level of circulating APOL1, probably mediates APOL1-associated kidney disease in HIV-infected African Americans.
24206458 Renal risk variants in APOL1 were associated with the higher rates of end-stage renal disease and progression of chronic kidney disease that were observed in black patients as compared with white patients, regardless of diabetes status.
24173214 finding supports the hypothesis that induction of APOL1 contributes to HIV-1 suppression in differentiated monocytes
24173214 APOL1 downregulates the steady-state levels of HIV-1 Vef in cells transfected by HIV-1 clones
24157943 Variants in NPHS2, SDCCAG8 and near BMP4 appear to interact with APOL1 to modulate the risk for non-diabetic end stage kidney disease in african americans.
24119848 data support an important role for APOL1 in the progression of diverse etiologies of kidney disease, in concert with requisite environmental (gene*environment) and inherited (gene*gene) interactions [review]
24011553 Possible genetic association link between keloids, non-diabetic kidney disease, and the APOL1-MYH9 haplotype amongst humans of African descent.
23860441 APOL1 risk variants are common in the Igbo population of south-eastern Nigeria, and are also highly associated with non-diabetic chronic kidney disease (CKD) in this area; APOL1 may explain the increased prevalence of CKD in this region
23768513 High levels of nonsynonymous polymorphism in the APOL1 regions encoding the functional domains that are required for lysing parasites are observed in humans with exposure to two Trypanosoma brucei subspecies that cause human African trypanosomiasis.
23766536 APOL1 variants associate with increased risk of CKD among African Americans.
23748364 Variation in the donor apolipoprotein L1 (APOL1), caveolin 1 (CAV1), and multi-drug resistance 1 encoding P-glycoprotein genes (ABCB1) are all associated with graft survival after kidney transplantation. [Review]
23715117 Host APOL1 genotype is independently associated with proteinuria in HIV infection.
23677244 African Americans at increased risk for APOL1-associated nephropathy (two APOL1 risk variants) with JC viruria had a lower prevalence of kidney disease, suggesting that JCV interaction with APOL1 genotype may influence kidney disease risk.
23520206 APOL1 genotyping of African-American patients with systemic lupus erythematosus (SLE) might help identify patients at risk for collapsing glomerulopathy.
23438974 Arguing by exclusion, it is reasonable to conclude that the putative APOL1 causal variants are not proxies for any other variants with more direct roles in kidney disease.
23300552 APOL1 null alleles do not correlate with glomerulosclerosis.
23107266 APOL1 protein genetic variants are risk for kidney transplantation living donors in african americans.
23082501 evidence of natural selection of these apoL1 mutations despite their deleterious potential for kidneys highlights the importance of the resistance to trypanosomes in the evolution of Man. [lecture]
22956460 APOL1 risk variants are associated with non-diabetic forms of CKD among Nigerians of Yoruba ethnicity
22878977 review focuses on the population genetics of non-diabetic chronic kidney disease with an emphasis on recent discoveries pertaining to the chromosome 22q12.3 region, containing the APOL1 gene as a major locus for chronic kidney disease risk
22832513 Apolipoprotein L1 gene variants associate with hypertension-attributed nephropathy and the rate of kidney function decline in African Americans.
22695330 Report association of APOL1 variants with mild kidney disease in the first-degree relatives of African American patients with non-diabetic end-stage renal disease.
22691369 APOL1 expression is likely induced by bloodborne Trypanosoma brucei gambiense, but is not related to resistance/susceptibility in its human host.
22569246 discussion of role of ApoL1 in renal cell carcinoma and chronic kidney disease: Intracellularly, elevated ApoL1 can induce autophagy and autophagy-associated cell death, which may be critical in maintenance of cellular homeostasis in kidney. [REVIEW]
22495294 There were no differences in the pathological findings of HIV-associated nephropathy and the number of APOL1 risk alleles.
22487534 conclude that APOL1 genotypes do not increase risk of allograft loss after kidney transplantations, and carrying 2 APOL1 risk alleles should not be an impediment to transplantation
22357707 APOL1 allelic variants are associated with lower age of dialysis initiation and thereby increased dialysis vintage in African and Hispanic Americans with non-diabetic end-stage kidney disease.
22239288 The current study has provided evidence that genetic variations of polymorphic sites in apoL-I gene might affect plasma TG variability in nonobese Chinese subjects, but are not associated with obesity in the population.
22135313 an association between APOL1 variants and renal outcomes in non-HIVAN kidney disease, suggesting a possible use for APOL1 genotyping to help guide the care of HIV-infected patients.
22119407 A genome-wide association study provides additional and independent evidence that APOL1 variants contribute to nondiabetic nephropathy in African Americans.
21997398 Genetic variations in APOL1 identify African Americans that initiate chronic hemodialysis at a younger age.
21997397 These data further support the strong association of genetic variants in APOL1 with susceptibility to focal segmental glomerulosclerosis and HIV nephropathy among African Americans.
21997396 Our data suggest that more than 3 million African Americans likely have the high-risk genotype and are at markedly increased risk for nondiabetic chronic kidney disease.
21997394 African Americans carrying two APOL1 risk alleles have a greatly increased risk for glomerular disease, and APOL1-associated focal segmental glomerulosclerosis occurs earlier and progresses to kidney failure more rapidly.
21997392 Comparing the renal distribution of APOL1 in nondiabetic kidney disease to normal kidney suggests that a previously unrecognized arteriopathy may contribute to disease pathogenesis in patients of African ancestry.
21968148 The coinciding absence of HIVAN and the APOL1 risk variants among HIV-infected individuals of Ethiopian ancestry support a Western rather than Pan-African ancestry risk for end-stage kidney disease.
21931123 Coding variants in the apolipoprotein L1 gene are strongly associated with non-diabetic nephropathy in African Americans.
21910715 Data provide insight into the pathobiology of renal dysfunction in SCD, suggesting that MYH9 and APOL1 are both associated with risk.
21698141 type 2 diabetic nephropathy-associated FRMD3 SNPs were detectable in African Americans only after accounting for MYH9, with differential effects for APOL1
21537348 The powerful evolutionary selection pressure of an infectious pathogen in West Africa favored the spread of APOL1 variants that protect against a lethal form of African sleeping sickness but are highly associated with an increased risk of kidney disease
21486385 APOL1 genotype has a role in failure of kidney after renal transplantation in African American deceased donors
21080072 Susceptibility of African-Americans to nondiabetic chronic kidney disease is likely due to functional variants of APOL1 that have been selected for because of their ability to protect from parasital infection
20855565 Observational study of gene-disease association. (HuGE Navigator)
20805508 show that trypanosome lytic factor-1 resistance in Trypanosoma brucei brucei is caused by reduced expression of the Hp/Hb receptor gene.
20668430 A risk allele for focal segmental glomerulosclerosis in African Americans is located within a region containing APOL1 and MYH9.
20668430 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20647424 in African Americans, focal segmental glomerulosclerosis and hypertension-attributed end-stage kidney disease are associated with 2 independent sequence variants in APOL1 gene; only kidney disease-associated ApoL1 variants lysed Trypanosoma rhodesiense
20647424 Observational study of gene-disease association. (HuGE Navigator)
20635188 missense mutations with predicted functional effects in the APOL1 gene are significantly more associated with ESKD than all previously reported SNPs in MYH9
20635188 Coding region mutations in the APOL1 gene are highly associated with end stage kidney disease in African and Hispanic Americans.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20483474 This study did not find DAOA significant associations with schizophrenia. Thus, APOL1 genes do not fit the antagonistic pleiotropy model.
20483474 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19324878 at low pH. Trypanosome lytic factor, apoL-1, and apoA-1 exhibit specificity for anionic membranes, whereas Hpr permeabilizes both anionic and zwitterionic membranes.
19239905 The Lys166Glu and Ile244Met polymorphisms in apoL-I gene are associated with TG levels in subjects with endogenous hypertriglyceridemia in Chinese. However, these polymorphisms were not associated with the risk of HTG in the population.
19239905 Observational study of gene-disease association. (HuGE Navigator)
18927493 APOL1 is the first BH3-only protein with lipid binding activity that, when overproduced intracellularly, induces autophagic cell death.
18850207 Observational study of gene-disease association. (HuGE Navigator)
18632255 An association of APOL1, 2 and 4 with schizophrenia was establised.
18632255 Observational study of gene-disease association. (HuGE Navigator)
18505729 Apolipoprotein L1 is a novel Bcl-2 homology domain 3-only lipid-binding protein, induces autophagic cell death
17845074 Infection by Trypanosoma brucei brucei causes hemolysis that triggers activation of trypanosome lytic factor by formation of haptoglobin-related protein-hemoglobin complexes, enhancing binding, trypanolytic activity, and clearance of parasites
17360487 apoL-I is responsible for the trypanolytic activity of normal human serum, whereas Hpr allows fast uptake of the carrier HDL particles in trypanolysis
16020735 contains a membrane pore-forming domain; APOL1 was targeted to the lysosomal membrane of Trypanosoma brucei & triggered depolarization of the membrane, continuous influx of chloride & subsequent osmotic swelling of the lysosome until the trypanosome lysed
15949655 Observational study of gene-disease association. (HuGE Navigator)
15604524 The Apolipoprotein L-I (apoL-I) is present on a subset of HDL particles and is positively correlated with plasma triglycerides (TGs).
15500911 identified as component of trypanosome lytic factor 1 (TLF1); apoL-I alone is not sufficient for optimal trypanosome lytic activity in human TLF1.
12837283 APOL1 is a senescence-associated gene in normal human oral keratinocytes.
12621437 ApoL-I is the trypanosome lytic factor of normal human serum, and serum resistance associated protein confers resistance to lysis by interaction with apoL-I in the lysosome
11944986 APOL1 has been found only in humans and African green monkeys

AA Sequence

MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTMDPESSIFIED      1 - 70
AIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLARQMIMKDKNWHDKGQQYRNWF     71 - 140
LKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSGSLSISSGILTLVGMGLAPFTEGGSLVLLEP    141 - 210
GMELGITAALTGITSSTMDYGKKWWTQAQAHDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIG    211 - 280
KDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVV    281 - 350
YLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL                          351 - 398
//

Text Mined References (126)

PMID Year Title
27054572 2016 Deceased-Donor Apolipoprotein L1 Renal-Risk Variants Have Minimal Effects on Liver Transplant Outcomes.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26699492 2016 APOL1 kidney disease risk variants cause cytotoxicity by depleting cellular potassium and inducing stress-activated protein kinases.
26634651 2016 APOL1 Genotype, Kidney and Cardiovascular Disease, and Death in Older Adults.
26586272 2016 Characterization of circulating APOL1 protein complexes in African Americans.
26566060 2016 APOL1 Genotype and Kidney Transplantation Outcomes From Deceased African American Donors.
26430087 2015 Examination of Potential Modifiers of the Association of APOL1 Alleles with CKD Progression.
26307671 2015 Coupling of lysosomal and mitochondrial membrane permeabilization in trypanolysis by APOL1.
26180129 2016 APOL1 Genotype and Race Differences in Incident Albuminuria and Renal Function Decline.
26150607 2016 Integrative Genomics Identifies Novel Associations with APOL1 Risk Genotypes in Black NEPTUNE Subjects.
26147622 2015 In vivo Modeling Implicates APOL1 in Nephropathy: Evidence for Dominant Negative Effects and Epistasis under Anemic Stress.
26112018 2015 APOL1 genetic variants, chronic kidney diseases and hypertension in mixed ancestry South Africans.
26108665 2015 BH3 domain-independent apolipoprotein L1 toxicity rescued by BCL2 prosurvival proteins.
26091559 2015 Protein domains of APOL1 and its risk variants.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26089538 2015 Biogenesis and cytotoxicity of APOL1 renal risk variant proteins in hepatocytes and hepatoma cells.
26038529 2015 APOL1 Risk Alleles Are Associated with Exaggerated Age-Related Changes in Glomerular Number and Volume in African-American Adults: An Autopsy Study.
26025194 2015 APOL1 G1 genotype modifies the association between HDLC and kidney function in African Americans.
25993319 2015 Sequencing rare and common APOL1 coding variants to determine kidney disease risk.
25933006 2015 Copy Number Variation at the APOL1 Locus.
25924622 2015 Exon 4-encoded sequence is a major determinant of cytotoxicity of apolipoprotein L1.
25921719 2015 APOL1 Genotype and Glomerular and Tubular Kidney Injury in Women With HIV.
25887069 2015 Hemostatic Factors, APOL1 Risk Variants, and the Risk of ESRD in the Atherosclerosis Risk in Communities Study.
25853332 2015 APOL1 toxin, innate immunity, and kidney injury.
25809272 2015 Apolipoprotein L1 gene variants in deceased organ donors are associated with renal allograft failure.
25788523 2015 APOL1 Risk Variants Are Strongly Associated with HIV-Associated Nephropathy in Black South Africans.
25730870 2015 Human trypanolytic factor APOL1 forms pH-gated cation-selective channels in planar lipid bilayers: relevance to trypanosome lysis.
25573908 2015 Clinical Features and Histology of Apolipoprotein L1-Associated Nephropathy in the FSGS Clinical Trial.
25530085 2015 Clinical phenotype of APOL1 nephropathy in young relatives of patients with end-stage renal disease.
25416956 2014 A proteome-scale map of the human interactome network.
25349204 2015 Effect of Genetic African Ancestry on eGFR and Kidney Disease.
25249559 2015 Lack of Association of the APOL1 G3 Haplotype in African Americans with ESRD.
25168832 2014 APOL1 kidney risk alleles: population genetics and disease associations.
25100047 2015 Innate immunity pathways regulate the nephropathy gene Apolipoprotein L1.
25081748 2015 Histopathologic findings associated with APOL1 risk variants in chronic kidney disease.
25054777 2015 APOL1 associations with nephropathy, atherosclerosis, and all-cause mortality in African Americans with type 2 diabetes.
25029429 2015 Apolipoprotein L1 gene variants associate with prevalent kidney but not prevalent cardiovascular disease in the Systolic Blood Pressure Intervention Trial.
24899058 2014 APOL1 risk variants enhance podocyte necrosis through compromising lysosomal membrane permeability.
24808134 2014 Evolution of the primate trypanolytic factor APOL1.
24731740 2014 Histopathologic effect of APOL1 risk alleles in PLA2R-associated membranous glomerulopathy.
24658608 2014 MYH9 and APOL1 gene polymorphisms and the risk of CKD in patients with lupus nephritis from an admixture population.
24518129 2014 APOL1 polymorphisms and development of CKD in an identical twin donor and recipient pair.
24504811 2014 End-stage renal disease in African Americans with lupus nephritis is associated with APOL1.
24379297 2014 Increased burden of cardiovascular disease in carriers of APOL1 genetic variants.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24233469 2014 The biology of APOL1 with insights into the association between APOL1 variants and chronic kidney disease.
24231663 2014 Plasma apolipoprotein L1 levels do not correlate with CKD.
24206458 2013 APOL1 risk variants, race, and progression of chronic kidney disease.
24173214 2014 The innate immune factor apolipoprotein L1 restricts HIV-1 infection.
24157943 2014 Gene-gene interactions in APOL1-associated nephropathy.
24119848 2013 APOL1 and nephropathy progression in populations of African ancestry.
24011553 2013 Keloids and non-diabetic kidney disease: similarities and the APOL1-MYH9 haplotype as a possible genetic link.
23860441 2013 High population frequencies of APOL1 risk variants are associated with increased prevalence of non-diabetic chronic kidney disease in the Igbo people from south-eastern Nigeria.
23768513 2013 Identifying Darwinian selection acting on different human APOL1 variants among diverse African populations.
23766536 2013 APOL1 variants associate with increased risk of CKD among African Americans.
23748364 2014 The impact of APOL1, CAV1, and ABCB1 gene variants on outcomes in kidney transplantation: donor and recipient effects.
23715117 2013 Host APOL1 genotype is independently associated with proteinuria in HIV infection.
23677244 2013 JC polyoma virus interacts with APOL1 in African Americans with nondiabetic nephropathy.
23520206 2013 Apolipoprotein L1 risk variants associate with systemic lupus erythematosus-associated collapsing glomerulopathy.
23438974 2013 APOL1 variants and kidney disease in people of recent African ancestry.
23300552 2012 APOL1 null alleles from a rural village in India do not correlate with glomerulosclerosis.
23107266 2012 The AJT Report: news and issues that affect organ and tissue transplantation. Genetic factor may limitkidney donation.
23082501 2011 [Molecular dialogue between African trypanosomes and humans].
22956460 2013 Genetic variation in APOL1 and MYH9 genes is associated with chronic kidney disease among Nigerians.
22878977 Population genetics of chronic kidney disease: the evolving story of APOL1.
22832513 2013 Apolipoprotein L1 gene variants associate with hypertension-attributed nephropathy and the rate of kidney function decline in African Americans.
22695330 2012 Association of APOL1 variants with mild kidney disease in the first-degree relatives of African American patients with non-diabetic end-stage renal disease.
22691369 2012 APOL1 expression is induced by Trypanosoma brucei gambiense infection but is not associated with differential susceptibility to sleeping sickness.
22569246 2012 Human apolipoprotein L1 (ApoL1) in cancer and chronic kidney disease.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22495294 2012 HIV-associated nephropathy patients with and without apolipoprotein L1 gene variants have similar clinical and pathological characteristics.
22487534 2012 The APOL1 genotype of African American kidney transplant recipients does not impact 5-year allograft survival.
22357707 2012 APOL1 allelic variants are associated with lower age of dialysis initiation and thereby increased dialysis vintage in African and Hispanic Americans with non-diabetic end-stage kidney disease.
22239288 2012 Association study of apolipoprotein L-I Lys166Glu and Ile244Met gene variants with obesity in Chinese subjects.
22135313 2012 APOL1 risk variants predict histopathology and progression to ESRD in HIV-related kidney disease.
22119407 2012 Genetic association and gene-gene interaction analyses in African American dialysis patients with nondiabetic nephropathy.
21997398 2011 Genetic variation in APOL1 associates with younger age at hemodialysis initiation.
21997397 2011 APOL1 variants increase risk for FSGS and HIVAN but not IgA nephropathy.
21997396 2011 Population-based risk assessment of APOL1 on renal disease.
21997394 2011 APOL1 genetic variants in focal segmental glomerulosclerosis and HIV-associated nephropathy.
21997392 2011 APOL1 localization in normal kidney and nondiabetic kidney disease.
21968148 2011 Absence of APOL1 risk variants protects against HIV-associated nephropathy in the Ethiopian population.
21931123 2011 Apolipoprotein L1 nephropathy risk variants associate with HDL subfraction concentration in African Americans.
21910715 2011 MYH9 and APOL1 are both associated with sickle cell disease nephropathy.
21698141 2011 Differential effects of MYH9 and APOL1 risk variants on FRMD3 Association with Diabetic ESRD in African Americans.
21537348 2011 The population genetics of chronic kidney disease: insights from the MYH9-APOL1 locus.
21486385 2011 The APOL1 gene and allograft survival after kidney transplantation.
21080072 2010 Arrest of the true culprit and acquittal of the innocent? Genetic revelations charge APOL1 variants with kidney disease susceptibility.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20805508 2010 Mechanism of Trypanosoma brucei gambiense (group 1) resistance to human trypanosome lytic factor.
20668430 2010 A risk allele for focal segmental glomerulosclerosis in African Americans is located within a region containing APOL1 and MYH9.
20647424 2010 Association of trypanolytic ApoL1 variants with kidney disease in African Americans.
20635188 2010 Missense mutations in the APOL1 gene are highly associated with end stage kidney disease risk previously attributed to the MYH9 gene.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20483474 2010 Testing the antagonistic pleiotropy model of schizophrenia susceptibility by analysis of DAOA, PPP1R1B, and APOL1 genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19324878 2009 Membrane permeabilization by trypanosome lytic factor, a cytolytic human high density lipoprotein.
19239905 2009 Distribution and effect of apoL-I genotype on plasma lipid and apolipoprotein levels in Chinese normalipidemic and endogenous hypertriglyceridemic subjects.
18927493 2008 ApoL1, a BH3-only lipid-binding protein, induces autophagic cell death.
18850207 2006 Polymorphisms in the Apolipoprotein L1 gene and their effects on blood lipid and glucose levels in middle age males.
18632255 2008 Association of SNPs and haplotypes in APOL1, 2 and 4 with schizophrenia.
18505729 2008 Apolipoprotein L1, a novel Bcl-2 homology domain 3-only lipid-binding protein, induces autophagic cell death.
17845074 2007 Hemoglobin is a co-factor of human trypanosome lytic factor.
17360487 2007 Distinct roles of haptoglobin-related protein and apolipoprotein L-I in trypanolysis by human serum.
17192540 2006 Human Trypanosoma evansi infection linked to a lack of apolipoprotein L-I.
17154273 2007 Proteomic analysis of human very low-density lipoprotein by two-dimensional gel electrophoresis and MALDI-TOF/TOF.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16020735 2005 Apolipoprotein L-I promotes trypanosome lysis by forming pores in lysosomal membranes.
15949655 2005 Investigation of the apolipoprotein-L (APOL) gene family and schizophrenia using a novel DNA pooling strategy for public database SNPs.
15604524 2005 Apolipoprotein L-I is positively associated with hyperglycemia and plasma triglycerides in CAD patients with low HDL.
15500911 2004 Characterization of primate trypanosome lytic factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837283 2003 Senescence-associated genes in normal human oral keratinocytes.
12621437 2003 Apolipoprotein L-I is the trypanosome lytic factor of human serum.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944986 2002 The apolipoprotein L gene cluster has emerged recently in evolution and is expressed in human vascular tissue.
11374903 2001 The human apolipoprotein L gene cluster: identification, classification, and sites of distribution.
11290834 2001 Apolipoprotein L gene family: tissue-specific expression, splicing, promoter regions; discovery of a new gene.
10946010 2000 Plasma apolipoprotein L concentrations correlate with plasma triglycerides and cholesterol levels in normolipidemic, hyperlipidemic, and diabetic subjects.
10591208 1999 The DNA sequence of human chromosome 22.
9325276 1997 Apolipoprotein L, a new human high density lipoprotein apolipoprotein expressed by the pancreas. Identification, cloning, characterization, and plasma distribution of apolipoprotein L.