Property Summary

NCBI Gene PubMed Count 21
PubMed Score 35.43
PubTator Score 21.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.783 3.4e-03

Gene RIF (12)

PMID Text
25726912 Direct interactions between C/EBPalpha and ETS-1 were important for high liver-specific expression of ApoF.
24211198 this study has identified apoF as likely another target gene of FXR.
21937674 LTIP translocation is dependent on LDL lipid composition
20855565 Observational study of gene-disease association. (HuGE Navigator)
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
18369235 lipoprotein composition may influence the status of lipid transfer inhibitor protein activity
17901467 we have confirmed the negative association between plasma triglyceride levels and Apolipoprotein F previously suggested by a small data set, but now we demonstrate that this effect is seen only in males.
15172102 Observational study of gene-disease association. (HuGE Navigator)
12907677 LTIP tailors CETP-mediated remodeling of HDL3 and HDL2 particles in subclass-specific ways, strongly implicating it as a regulator of HDL metabolism

AA Sequence

MTGLCGYSAPDMRGLRLIMIPVELLLCYLLLHPVDATSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHP      1 - 70
KSLPGFSHMAPLPKFLVSLALRNALEEAGCQADVWALQLQLYRQGGVNATQVLIQHLRGLQKGRSTERNV     71 - 140
SVEALASALQLLAREQQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNLGTALYYATQNCLGKA    141 - 210
RERGRDGAIDLGYDLLMTMAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRA    211 - 280
ISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSYDLDPGAGSLEI                            281 - 326
//

Text Mined References (24)

PMID Year Title
25726912 2015 Transcriptional regulation of the apolipoprotein F (ApoF) gene by ETS and C/EBP? in hepatoma cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211198 2013 Farnesoid X receptor up-regulates expression of lipid transfer inhibitor protein in liver cells and mice.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21937674 2011 Conversion of lipid transfer inhibitor protein (apolipoprotein F) to its active form depends on LDL composition.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
18369235 2008 Control of cholesteryl ester transfer protein activity by sequestration of lipid transfer inhibitor protein in an inactive complex.
17901467 2008 Lipid transfer inhibitor protein (apolipoprotein F) concentration in normolipidemic and hyperlipidemic subjects.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15172102 2004 Exclusion of CYP46 and APOM as candidate genes for Alzheimer's disease in a French population.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12907677 2003 Lipid transfer inhibitor protein defines the participation of high density lipoprotein subfractions in lipid transfer reactions mediated by cholesterol ester transfer protein (CETP).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9880564 1999 Molecular cloning and expression of lipid transfer inhibitor protein reveals its identity with apolipoprotein F.
8093033 1994 Purification and molecular cloning of human apolipoprotein F.
6816269 1982 Isolation and characterization of simple and complex lipoproteins containing apolipoprotein F from human plasma.
204339 1978 Isolation and partial characterization of a new acidic apolipoprotein (apolipoprotein F) from high density lipoproteins of human plasma.