Property Summary

NCBI Gene PubMed Count 4,009
PubMed Score 15904.90
PubTator Score 12114.18

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 8.157 4.0
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Familial hyperlipidemia 6 0.0 4.0
Neurodegenerative disease 414 0.0 4.0


Protein-protein Interaction (1)

Gene RIF (4459)

AA Sequence

SWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH                                     281 - 317

Text Mined References (4019)

PMID Year Title