Property Summary

NCBI Gene PubMed Count 4,009
PubMed Score 15904.90
PubTator Score 12114.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Alzheimer's disease 658 8.157 4.0
Cardiovascular system disease 246 0.0 3.0
Disease Target Count Z-score Confidence
Familial hyperlipidemia 6 0.0 4.0
Neurodegenerative disease 414 0.0 4.0

Expression

Protein-protein Interaction (1)

PDB (17)

Gene RIF (4459)

AA Sequence

MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELL      1 - 70
SSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEV     71 - 140
QAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRA    141 - 210
ATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLK    211 - 280
SWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH                                     281 - 317
//

Text Mined References (4019)

PMID Year Title