Property Summary

NCBI Gene PubMed Count 3,775
PubMed Score 15380.36
PubTator Score 12114.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
medulloblastoma 1524 6.65693491203807E-8
acute quadriplegic myopathy 1157 2.59338835009765E-7
Duchenne muscular dystrophy 602 3.80741502959728E-7
malignant mesothelioma 3163 3.07061358477855E-6
juvenile dermatomyositis 1189 6.20683643204845E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 7.75090494021408E-6
medulloblastoma, large-cell 6234 8.84686028791529E-5
head and neck cancer and chronic obstructive pulmonary disease 237 1.57007636748599E-4
posterior fossa group B ependymoma 1530 1.92678442057917E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.17143248434374E-4
oligodendroglioma 2849 0.0010347746490385
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00104164892864439
ulcerative colitis 2087 0.0010694588973232
ovarian cancer 8492 0.00192389842638403
invasive ductal carcinoma 2950 0.00294923162675913
osteosarcoma 7933 0.00485806191714828
Atopic dermatitis 944 0.0126809050611957
nasopharyngeal carcinoma 1056 0.0162748571358814
astrocytic glioma 2241 0.0189700423695555
glioblastoma 5572 0.0191861940820728
non primary Sjogren syndrome sicca 840 0.0196374087140459
adrenocortical carcinoma 1427 0.0203643936326699
gastric carcinoma 832 0.0240088492411854
interstitial cystitis 2299 0.0280188222956441
nephrosclerosis 329 0.0444090497143979
esophageal adenocarcinoma 737 0.0446543754416017
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0493486357237295
Disease Target Count Z-score Confidence
Alzheimer's disease 644 8.158 4.0
Cardiovascular system disease 194 0.0 2.0
Disease Target Count Z-score Confidence
Age related macular degeneration 84 3.795 1.9

Expression

Synonym

Accession P02649 B2RC15 C0JYY5 Q9P2S4 Apo-E
Symbols AD2
LPG
APO-E
ApoE4
LDLCQ5

Gene

PDB

1B68   1BZ4   1EA8   1GS9   1H7I   1LE2   1LE4   1LPE   1NFN   1NFO   1OEF   1OEG   1OR2   1OR3   2KC3   2KNY   2L7B  

  Ortholog (12)

Gene RIF (4249)

PMID Text
27117804 Higher peak velocity-reactivity in APOE epsilon4 carriers suggests vascular compensation for deleterious effects of this known risk allele for Alzheimer's disease and stroke
27078154 Data suggest that the apolipoprotein E (APOE) genotyping method with a flexible throughput is suitable for DNA template from different preparations.
27065111 The apolipoprotein E genotype is a powerful risk factor for late-onset Alzheimer's disease.
26998902 elderly community dwelling residents of Han ethnicity carrying the APOE epsilon3/epsilon3 genotype might have higher plasma glucose levels and a higher occurrence of diabetes.
26996551 Nevertheless, the expression levels of ApoA-1, ApoC-III, and ApoE were not correlated with SCLC staging
26980363 APOE status did not affect change in depressive symptoms in response to physical activity intervention in older adults.
26958821 Presence of epsilon4 allele was associated with lower odds of mobility deficit (OR = 0.65; 95%CI: 0.47-0.92) in the adjusted analysis.
26948379 Sporadic Abeta accumulation may be partly associated with increased amyloidogenic APP production, especially in APOE varepsilon4-negative subjects.
26945380 APOEepsilon4 allele possible risk factor for nonlesional mesial temporal lobe epilepsy
26903389 The APOE epsilon2 allele increases the risk of Frontotemporal Dementia in ALS patients.
More...

AA Sequence

MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELL      1 - 70
SSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEV     71 - 140
QAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRA    141 - 210
ATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLK    211 - 280
SWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH                                     281 - 317
//

Text Mined References (3786)

PMID Year Title
27117804 2016 Cardiometabolic risk factors predict cerebrovascular health in older adults: results from the Brain in Motion study.
27078154 2016 Development of a Melting Curve-Based Allele-Specific PCR of Apolipoprotein E (APOE) Genotyping Method for Genomic DNA, Guthrie Blood Spot, and Whole Blood.
27065111 2016 Influence of APOE Genotype on Hippocampal Atrophy over Time - An N=1925 Surface-Based ADNI Study.
26998902 2016 Enhanced Diabetes Susceptibility in Community Dwelling Han Elders Carrying the Apolipoprotein E 3/3 Genotype.
26996551 2016 Apolipoproteins as Differentiating and Predictive Markers for Assessing Clinical Outcomes in Patients with Small Cell Lung Cancer.
26980363 2016 Genetic Moderators of the Impact of Physical Activity on Depressive Symptoms.
26958821 2016 Apolipoprotein E polymorphism and functional disability in Brazilian elders: the Bambuí Health and Aging Study.
26948379 2016 Increased amyloidogenic APP processing in APOE ?4-negative individuals with cerebral ?-amyloidosis.
26945380 2016 Apolipoprotein E ?4 Allele was Associated With Nonlesional Mesial Temporal Lobe Epilepsy in Han Chinese Population.
26903389 2016 The Role of APOE in the Occurrence of Frontotemporal Dementia in Amyotrophic Lateral Sclerosis.
More...