Property Summary

NCBI Gene PubMed Count 353
PubMed Score 836.71
PubTator Score 678.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 1.3e-05

Gene RIF (346)

PMID Text
26996551 ApoA-1 and ApoC-III may be used as differentiating and predictive markers for SCLC [ small cell lung cancer ].
26790392 D25V apolipoprotein C-III is a new human amyloidogenic protein and the first conferring cardioprotection.
26782469 The results of our meta-analysis point to a strong link between both APOA5 -1131T>C and APOC3 -455T>C polymorphisms and an increased risk of coronary heart disease .
26625519 In examined Kyrgyz ethnic population the most frequent was heterozygous TC genotype of T455C polymorphism of apo C-III.
26516010 APOC3 loss-of- function mutation carriers had reduced plasma triglycerides, higher HDL-C,and a decreased burden of coronary arterial calcification.
26491253 Low levels of APOA1, APOC3, and APOA4 are associated with risk of Alzheimer disease.
26485402 the present findings reveal that High-altitude polycythemia -induced gastric mucosal lesion inspires the protection responses by up-regulating APOA4 and APOC3, and down-regulating GIF.
26452348 HDL-apoCIII has a significant and positive association with coronary heart disease .
26387083 APOA5 -1131 T > C and APOC3 -455 T > C SNPs may play potent roles in the development and progression of coronary heart disease. (Meta-analysis)
26301570 Data suggest that apolipoprotein C-III (ApoCIII) adopts an alternate helical conformation on the bilayer which could have functional implications.
26247234 3238C>G polymorphism of ApoC3 gene appears to augment the propensity to develop T2DM, while -482C>T to negatively affect lipid metabolism in Saudi subjects.
26228667 The current body of literature includes several methodologically sound studies that together provide consistent evidence for an association of cardiovascular events with blood apoC-III level in total plasma or in VLDL and LDL.
26117401 Lipoprotein associated phospholipase A2 activity and apolipoprotein C3 loss-of-function variants are involved in cardiovascular disease
26069232 In persons with T2DM, increased plasma ApoC-III is associated with higher triglycerides, less favorable cardiometabolic phenotypes, and higher coronary artery calcification, a measure of subclinical atherosclerosis.
25994465 Confirming the negative role of APOC-III in TG metabolism can be used as therapeutic target for the management of hypertriglyceridemia and reduction of ischemic cardiovascular events.
25994187 genetic variants associated with elevated triglycerides and VLDL and risk of intracerebral hemorrhage
25979856 Clematichinenoside prevented dyslipidemia-induced atherosclerosis via hepatic PPARalpha/APOA1/APOA2/APOC3 metabolism.
25928461 meta-analysis demonstrates significant association between rs5128 polymorphism and higher levels of APOC3, TG, TC and LDL-C
25653052 genetic association study in population in Iran: Data suggest SNPs in APOA1 (rs670; rs5069) and APOC3 (rs5128) are associated with metabolic syndrome in combination with Western/high-fat/high-sugar diets in population studied.
25641685 The objective of this study was to evaluate the reliability of MALDI-TOF mass spectrometry of apoC-III for the detection and characterization of congenital disorders of glycosylation-associated O-glycan defects.
25463085 analysis of methylation patterns of the APOA1/C3/A4/A5 cluster that may be directly involved in the transcriptional regulation of this cluster, especially in liver
25380998 The APOC3 3238 G allele might contribute to an increased risk of coronary artery disease as a result of its effect on triglycerides and VLDL-cholesterol metabolism.
25363704 APOC3 R19X allele participants had approximately half the triglyceride levels, >20% higher high-density lipoprotein cholesterol levels, and lower low-density lipoprotein cholesterol levels compared with noncarrier participants.
25320541 APOC3 (-455T>C) genetic variation is involved in the susceptibility to developing NAFLD in the Southern Chinese Han population.
25319715 The polymorphism T-455C in APOC3 gene and elevated serum triglycerides were associated with NAFLD. However, we did not find a significant association of C-482T polymorphism (rs2854117) of APOC3 gene with NAFLD.
25301527 analysis of a diet-gene interaction between APOC3 rs5128 polymorphism and the Western dietary pattern in relation to metabolic syndrome risk
24972136 APOC3 T-455CC genotype is relatively prevalent in HIV infected cohort in nothern South Africa.
24966274 Obesity favors apolipoprotein E- and C-III-containing high density lipoprotein subfractions associated with risk of heart disease.
24941082 Loss-of-function mutations in APOC3 were associated with low levels of triglycerides and a reduced risk of ischemic cardiovascular disease.
24941081 Rare mutations that disrupt APOC3 function were associated with lower levels of plasma triglycerides and APOC3. Carriers of these mutations were found to have a reduced risk of coronary heart disease.
24707151 The two polymorphisms of the APOC3 gene are not associated with a risk of NAFLD, or with lipid profiles, IR and oxidative stress in the Chinese Han population
24685634 these results suggest that plasma apoA-I could be a sensitive Alzheimer's disease biomarker and individuals with low plasma levels of apoC-III are at risk for Alzheimer's disease.
24430880 ApoC3 Sst I and T-455C polymorphisms might be associated with coronary heart disease risk.
24343240 R19X variant in APOC3 increased high-density lipoprotein and decreased triglycerides levels in Greek population.
24242684 Elevated concentrations of Apo CIII are associated with an increase of thrombin activity to an extent comparable with the carriership of G20210A gene variant and mainly modulating the thrombin generation.
24211975 human apolipoproteina4 and apolipoproteinc3 genes are suppressed by phorbol myristate acetate in hepatic and intestinal cells
24121499 apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4.
23808989 APOC3 polymorphisms had no effect on the development of steatosis and no influence on the PNPLA3 polymorphism.
23804528 We have shown that variants of PNPLA3 and APOC3 independently and in an additive manner contribute to elevated hepatic triglyceride content in Hispanic children.
23701270 Heterozygosity for APOC3 mutations results in high HDL-C and low TGs and apoCIII levels.
23631828 Six apolipoproteins (APOA1, APOA2, APOB, APOC2, APOC3, and APOE) were able to differentiate bladder cancer from hernia. SAA4 was significantly increased in bladder cancer subgroups, whereas ProEGF was significantly decreased in bladder cancer subgroups.
23527852 Identification of six new apoCIII isoforms with low-ppm mass measurement errors and ultrahigh precision.
23512881 No association between APOC3 gene variant rs2854117 and histological or metabolic parameters of non-alcoholic fatty liver disease was found.
23377670 Lipoprotein lipase/APOC3 genotype determines severity of coronary artery disease.
23173569 Measurement of plasma ApoCIII may improve CAD prediction in the general population
22924697 differences in serum lipid parameters between drinkers and nondrinkers might partly result from different interactions between the ApoA1/C3/A5 haplotypes and alcohol consumption.
22848358 The genetic determination of APOC3 might have an impact on a large portion of HIV-1-infected children at the time of choosing the treatment regimens or on the counter-measures against the adverse effects of drugs.
22675253 Examined associations of SNPs and haplotypes in the APOA1/C3/A5 gene cluster with acute coronary syndromes in Chinese Han.
22301884 Antisense inhibition of apoB synthesis reduced plasma concentrations of apoC-III and apoC-III-containing lipoproteins.
22211242 The lipoprotein fractions in the angina pectoris group had impaired antioxidant activity and increased triglycerides and apoC-III with structural and functional changes.
22197810 Mdm2 inhibited p53-mediated enrichment of HNF4alpha to the ApoCIII promoter while simultaneously reducing p53 binding and increasing recruitment of SHP to the ApoCIII promoter.
22141340 Genetic variants in PNPLA3 but not APOC3 contribute to the variance in liver fat content due to non-alcoholic fatty liver disease.
22101237 Data suggest that APOC3 is up-regulated as early as the second trimester in women developing gestational diabetes.
22054125 Our data did not support a relationship between the two polymorphisms of APOC3 gene and risk of coronary heart disease in the Han population in East China
22023023 High apolipoprotein CIII is associated with hypertriglyceridemia
22004016 APOC3 -482TT genotype is independently associated with elevated fasting triglyceride concentrations in obese men
21986282 The risk of coronary heart disease contributed by LDL appeared to result to a large extent from LDL that contains apoC-III.
21939545 The A allelic variant of the rs10892151 polymorphism is not associated with serum apo C-III concentration, but predisposes HIV-infected patients to less favorable lipid profile, particularly in those patients treated with protease inhibitors.
21854571 Several common SNPs and their haplotypes in the ApoA1/C3/A5 gene cluster are closely associated with modifications of serum lipid parameters in the general Chinese population
21829161 APOC3 mRNA expression is increased in fatty liver and is regulated by SNPs in APOC3. The impact of the APOC3 SNPs on fatty liver is small and depends on visceral obesity
21777557 APOC3 SNPs, alone or in combination, were not associated with insulin resistance, altered lipid levels, liver enzymes, and with liver damage (severity of steatosis, nonalcoholic steatohepatitis, and moderate/severe fibrosis)
21767760 the ApoAI-CIII-AIV SacI polymorphism was associated with MI in Tunisian patients.
21676879 lipid binding domain of apoC-III plays a key role in the formation of LLD for hepatic VLDL assembly and secretion
21663607 there was no significant association between apolipoprotein C3 polymorphisms and fatty liver disease, lipid profiles, and insulin-resistance in Italian obese subjects
21646779 genetic association studies in a young adult population in China: An SNP in APOC3 (482C>T) [along with SNP in APOA5 (1131T>C)] is associated with elevated TG and lipoprotein-TG levels induced by high carbohydrate/low fat diet, especially in females.
21603779 the high-carbohydrate diet enhanced the adverse effect of the S2 allele on the triglyceride/high-density lipoprotein chlesterol ratio in the females of this cohort.
21499891 polymorphisms in the apolipoprotein C-III gene are associated with dyslipidemia and increased risk of myocardial infarction
21421846 Apolipoprotein C-III significantly affects the metabolism of the particle on which it resides, and in so doing, plays a central role in determining the concentration in the circulation of potentially atherogenic VLDL, IDL, and small dense LDL.
21373834 Lean carriers of the -482T allele of the APOC3 promoter had increased type 2 diabetes risk, while such an effect was not observed in overweight participants.
21321243 The ratio of plasma ApoCIII to ApoCII was significantly elevated in patients with severe preeclampsia relative to normotensive and gestational hypertensive individuals.
21297177 Altered plasma apoC-III metabolism is a feature of dyslipidemia in moderate chronic kidney disease.
21274868 There is no causal relationship between variants in APOC3 and either increased hepatic triglyceride content or insulin resistance in middle-aged men and women.
21267442 Serum levels of apoC-I and apoC-III combined with other clinical parameters can serve as a basis for the formulation of a diagnostic score for stomach cancer patients
21185820 the relationship of smoking status on APOC3 -482C>T polymorphism and apolipoprotein C-III (apoC-III) concentrations;influence on risk of diabetes and coronary heart disease
21183731 Glucose induces apoCIII transcription, which may represent a mechanism linking hyperglycemia, hypertriglyceridemia, and cardiovascular disease in type 2 diabetes.
21080234 Data suggest that apoC-III attenuates the binding of apoE to the lipoprotein surface and apoE-mediated cellular uptake of lipoprotein remnants.
21033077 Observational study of gene-disease association. (HuGE Navigator)
20855565 Observational study of gene-disease association. (HuGE Navigator)
20727869 The APOC3 SstI and the APOA1MspI polymorphisms were genotyped in postprandial response in metabolic syndrome patients.
20716347 ApoC-III SNP (3238C>G): impact on blood lipid/lipoprotein levels (especially TG level) in conjunction with alcohol consumption; allelic frequency in China
20716347 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20674306 single nucleotide polymorphisms in apolipoproteins A-I, C3, A4, and A5, as modulated by dietary fat intake, appear to influence allostatic load parameters in Puerto Ricans
20674306 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20517165 The present study was undertaken to detect the association of the apoC-III 3238C>G polymorphism and several environmental factors with serum lipid profiles in the Guangxi Hei Yi Zhuang and Han populations.
20517165 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20368524 central role for apoC-III in metabolic defects leading to hypertriglyceridemia
20335584 The polymorphisms C-482T and T-455C in APOC3 are associated with nonalcoholic fatty liver disease and insulin resistance.
20335584 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20303494 we demonstrated that increased plasma apoCIII concentration is associated with increased levels of small, dense LDL, a phenotype that confers increased cardiovascular disease risk
20097930 an important structural element residing within the N-terminal region of apoC-III that governs the second step VLDL(1) maturation
20071361 As a result of S. mansoni infection the glycosylation of a host protein is altered.
20031551 Observational study of gene-disease association. (HuGE Navigator)
20002542 Basal concentrations of apo C-III levels > or = 10.5 mg dL(-1) in coronary artery disease patients independently predicted cardiovascular mortality during the subsequent 5-year period and were associated with enhanced thrombin generation.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19932084 the possible association between the APOA5 and APOC3 gene variants with plasma apolipoprotein A5 level in patients with metabolic syndrome was studied.
19932084 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910636 ApoCIII strongly inhibits hepatic uptake of VLDL and IDL overriding the opposite influence of apoE when both are present. On light LDL, apoCIII is associated with enhanced conversion to dense LDL, a process involving hepatic lipase.
19878569 Observational study of gene-disease association. (HuGE Navigator)
19785722 Results identified haptoglobin alpha-1, apolipoprotein C-I and apolipoprotein C-III as candidate biomarkers in PTC.
19732897 polymorphisms in the apolipoprotein A1/C3/A4/A5 gene cluster may have roles in familial combined hyperlipidaemia in Hong Kong Chinese
19732897 Observational study of gene-disease association. (HuGE Navigator)
19701693 Observational study of gene-disease association. (HuGE Navigator)
19689828 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19656773 Observational study of gene-disease association. (HuGE Navigator)
19622837 expression of apoC-III in McA-RH7777 cells enhances hepatic triacylglycerol-rich VLDL assembly and secretion under lipid-rich conditions.
19592705 We have identified new associations between SNPs in the APOA1/C3/A4/A5 gene cluster and altered postprandial lipid metabolism.
19592705 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19534808 No significant differences were found between the acute hypertriglyceridaemic pancreatitis cases and controls with severe hypertriglyceridaemia in terms of LPL activity and mass, hepatic lipase activity, CII and CIII mass, or apo E polymorphisms.
19502413 enriching LDL with apoCIII only induced a small increase in LDL-proteoglycan binding, and this effect was dependent on a functional site A in apoB100
19501493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19424489 Significant associations between APOC3 polymorphisms, impaired cognition and metabolic dysregulation in Caribbean Hispanics with diabetes, were identified.
19424489 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19403283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19322776 loss of Neu5Ac (alpha2,6) Gal/GalNAc structure in apolipoprotein C-III (apoC-III) in lung cancer patients
19263529 Observational study of gene-disease association. (HuGE Navigator)
19207029 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19074352 heterozygous carriers of an APOC3 null mutation, R19X, express half the apoC-III as noncarriers; mutation carriers had lower serum triglycerides, higher HDL-cholesterol & lower LDL-cholesterol; subclinical atherosclerosis was less common in carriers
19074352 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19057464 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
19034316 Data show that the frequency of the rare allele of APOC3 3238 G>C and APOA5 -1131 T>C (in linkage disequilibrium) was significantly higher in type III HLP patients.
19034316 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19000312 n males with the APOC3 S1/S2 genotype, low birth weight was associated with lower apoA and higher Lp(a), yet this association was not observed in females
19000312 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18835943 High concentrations of ApoCIII are associated with increased triglycerides and decreased visceral fat mass in men with metabolic syndrome X.
18823627 Observational study of gene-disease association. (HuGE Navigator)
18801202 The present study aimed to elucidate the relationship of four single nucleotide polymorphisms (SNPs) in the Apo11q cluster, to plasma lipids and Coronary Artery Disease.
18801202 Observational study of gene-disease association. (HuGE Navigator)
18789138 Observational study of gene-disease association. (HuGE Navigator)
18767813 Ability of the lipid transporter ABCA1 and apolipoprotein CIII to promote the de novo biogenesis of apoCIII-containing high density lipoproteins in vivo.
18753860 Observational study of gene-disease association. (HuGE Navigator)
18678879 the apoCIII enhancer contributes to the maintenance of an active chromatin subdomain of the apoAI/CIII/AIV genes, but not apoAV
18660489 Observational study of gene-disease association. (HuGE Navigator)
18566295 Atorvastatin and fenofibrate have comparable effects on VLDL-apolipoprotein C-III kinetics in men with the metabolic syndrome.
18560672 There was a significant association between rare G allele and HTG in Japanese individuals living in Southern Brazil as indicated by one-way ANOVA, P < 0.05.
18556566 Triglyceride-rich lipoprotein-associated apolipoprotein C-III production is stimulated by plasma free fatty acids in humans.
18541587 Mutations in the APOC3 promoter inhibit the down-regulation of APOC3 expression by insulin which becomes dysfunctional in abdominal obesity and hyperglycemia.
18541587 Observational study of gene-disease association. (HuGE Navigator)
18513389 Observational study of gene-disease association. (HuGE Navigator)
18509206 Rosuvastatin decreases production and increases catabolism of VLDL apoC-III, a mechanism that accounted for the significant reduction in VLDL apoC-III and triglyceride concentrations in metabolic syndrome X.
18408013 analysis of structure and dynamics of human apolipoprotein CIII
18289550 Observational study of gene-disease association. (HuGE Navigator)
18274205 Observational study of gene-disease association. (HuGE Navigator)
18240956 Observational study of gene-disease association. (HuGE Navigator)
18206649 APOA1/C3/A5 haplotype represents an important locus for predicting risk of hypertriglyceridemia among Taiwanese
18206649 Observational study of gene-disease association. (HuGE Navigator)
18193043 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18188530 Observational study of gene-disease association. (HuGE Navigator)
18187430 Observational study of gene-disease association. (HuGE Navigator)
18096054 the functional -455T>C promoter polymorphism in APOC3 was associated with an approximately 2-fold increased risk of metabolic syndrome
18034366 Observational study of gene-disease association. (HuGE Navigator)
18020971 Observational study of gene-disease association. (HuGE Navigator)
17996965 Rev-erbbeta modulates the apoCIII gene expression by recruiting different transcription co-activator or co-repressor.
17964293 Observational study of gene-disease association. (HuGE Navigator)
17957542 Levels of oxidized proteins and apoCIII may be useful biomarkers in system lupus erythematosus.
17919884 Observational study of gene-disease association. (HuGE Navigator)
17885207 Results show that the for control of apolipoprotein C3 (APOC3), a gene associated with the differentiated hepatic phenotype, is acheived by the competition between c-Myc and HNF4alpha1.
17855807 Observational study of gene-disease association. (HuGE Navigator)
17853951 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17853951 APOC3 SstI polymorphisms may not be associated with gallstone disease
17825930 genetic variation of 3' flanking region of ApoA-I (PstI), 3' untranslated region of ApoC-III (SstI) and intron 2 of ApoA-IV (XbaI) in 193 angiographically diagnosed coronary heart disease Punjab patients
17825930 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17726453 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17700364 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17672999 Observational study of gene-disease association. (HuGE Navigator)
17654446 Polymorphisms in ApoAI-CIII-AIV gene cluster are associated with risks of diabetes and coronary heart disease.
17615573 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17457002 Observational study of gene-disease association. (HuGE Navigator)
17416293 Observational study of gene-disease association. (HuGE Navigator)
17416293 These data suggest that the APOC3 promoter polymorphisms C-482T and T-455C are associated with the metabolic syndrome.
17378725 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17378725 Variation in the apolipoprotein (APO) APOA1/C3/A4/A5 gene cluster on decreases in plasma cholesterol levels over an 8-year follow-up study.
17367769 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17367769 APOC3 polymorphisms were associated with lipid variables, but the magnitude of these associations was modulated by additional genetic, biologic and/or environmental factors.
17342071 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17342071 Combined with abdominal obesity, epistasis in the VLDL pathway (lipoprotein lipase, apolipoprotein CIII, hepatic lipase, PPARalpha, PPARgamma, and apo E genes) has a deleterious effect on fasting triglycerides and coronary artery disease risk profile
17318300 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17318300 The combined effect of LIPC, LIPE and ApoCIII gene polymorphisms may increase the likelihood of gestational hypertension, but seemingly not of preeclampsia.
17314277 hypertriglyceridemic subjects have significantly greater production of apoC-III-containing VLDL and global prolongation in residence time of all particle types
17283453 Observational study of gene-disease association. (HuGE Navigator)
17261136 Observational study of gene-disease association. (HuGE Navigator)
17197160 Observational study of gene-disease association. (HuGE Navigator)
17197160 Comparison between EWs with T2D and healthy EWs suggest APOC3 1100C>T is associated with increased risk of diabetes probably through mechanisms other than direct effects on TG.
17142127 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17038637 apoCIII may stimulate diverse inflammatory responses through monocyte activation
17032446 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17020471 Observational study of gene-disease association. (HuGE Navigator)
17016614 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16917759 Observational study of gene-disease association. (HuGE Navigator)
16864937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16864937 The ApoCIII S2 variant and environmental factors, including education, tribal background, BMI and starchy food intake, modulate the risks of Hypertriglyceridemia in aboriginal Taiwanese.
16861622 in hypertriglyceridemia patients, increased triglyceride levels are accompanied by high plasma levels of apoA-V and apoC-III, apolipoproteins with opposite modes of action
16813599 Observational study of gene-disease association. (HuGE Navigator)
16813599 combinations of genotypes [APOE epsilon3/epsilon3 and LPL 447X+, APOC3 CC and LPL 447X+, APOE epsilon3/epsilon3 and APOC3 CC were protective for diabetic nephropathy compared with the most common combination of the respective polymorphisms
16781717 Observational study of gene-disease association. (HuGE Navigator)
16781717 the variability in APOA1/C3/A4/A5 gene cluster may affect TG and HDL levels in women with type 2 diabetes
16769999 Observational study of gene-disease association. (HuGE Navigator)
16763159 Observational study of gene-disease association. (HuGE Navigator)
16710093 Observational study of gene-disease association. (HuGE Navigator)
16705465 Observational study of gene-disease association. (HuGE Navigator)
16705465 illustrate the impact of context-dependence on single nucleotide polymorphism selection for prediction of cardiovascular disea risk factor variability
16702309 Observational study of gene-disease association. (HuGE Navigator)
16682041 Observational study of gene-disease association. (HuGE Navigator)
16602826 Observational study of gene-disease association. (HuGE Navigator)
16602826 Because modulation of lipoproteins is also seen in genetically altered longevity models, it may be a common pathway influencing lifespan from nematodes to humans
16505251 Observational study of gene-disease association. (HuGE Navigator)
16495512 Results suggest that all apoC-III isoforms, especially the predominant CIII1 and CIII2 isoforms, contribute to hypertriglyceridemia and that ApoC-III2 may play a significant role in the expression of the small, dense LDL phenotype.
16430904 Observational study of gene-disease association. (HuGE Navigator)
16430904 Hypertension was associated with higher ICA IMT only in male carriers of the rare allele of the APOCIII Sst-1 variant (p for the interaction=0.041).
16417409 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16410456 increased VLDL-apoC-III concentrations resulting from an overproduction of VLDL-apoC-III are strongly associated with the delayed catabolism of triglycerides and apoB in VLDL
16343038 Observational study of gene-disease association. (HuGE Navigator)
16343038 Results show that the S1 allele of APOC3 SstI polymorphism might have a small effect on apoB levels in the Central European Caucasian population with dyslipidemia of metabolic syndrome.
16326171 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16326171 The APOC3 SstI polymorphism analysis revealed that heterozygous carriers of the S2 allele had higher (P < 0.05) plasma apo C-III and TG concentrations, regardless of gender or dietary period.
16321685 Observational study of gene-disease association. (HuGE Navigator)
16276364 Observational study of gene-disease association. (HuGE Navigator)
16205020 Observational study of gene-disease association. (HuGE Navigator)
16192625 Observational study of gene-disease association. (HuGE Navigator)
16192625 haplotypes in the APOC3 gene but not in the apolipoprotein A5 gene increase susceptibility to myocardial infarction
16136540 Observational study of genotype prevalence. (HuGE Navigator)
16030523 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16015281 Observational study of gene-disease association. (HuGE Navigator)
16015281 These results support an exacerbating effect of the APOC3 Sst I single-nucleotide polymorphism on fasting TG levels since a large number of smaller VLDL particles are observed in LPL-deficient men bearing the APOC3 S2 allele.
15983323 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15983323 The association between hepatic lipase T+ genotypes and diabetic nephropathy appeared stronger in diabetic patients with apoC3 -482 non-TT genotypes.
15962178 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15949705 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15924804 The APOA5-1131T/C polymorphism but not APOC3-482C/T might contribute to an increased risk of coronary artery disease.
15924804 Observational study of gene-disease association. (HuGE Navigator)
15910632 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15868628 Observational study of gene-environment interaction. (HuGE Navigator)
15864534 APO CIII metabolism is disturbed in type 2 diabetes.
15862889 Observational study of gene-disease association. (HuGE Navigator)
15862889 Therefore, we conclude that the rare APOC3 G allele may offer some protection against the development of sporadic AD in APOE epsilon4 noncarriers in Chinese.
15823278 Observational study of gene-disease association. (HuGE Navigator)
15809899 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15809899 Variant alleles of APOE and APOC3 contribute to an unfavorable lipid profile in patients with HIV, who are therefore at high risk for severe ritonavir-associated hypertriglyceridemia.
15778093 Different levels of secreted apoC-III had little effect on LDL and HDL protein degradation by HepG2 cells. Compared to controls, cells under-expressing under-expressing apoC-III demonstrated 70 and 160% higher capacity to take up CE from LDL and HDL.
15764642 Observational study of gene-disease association. (HuGE Navigator)
15715433 Observational study of gene-disease association. (HuGE Navigator)
15657615 Observational study of gene-disease association. (HuGE Navigator)
15649902 the apoCIII enhancer regulates expression of apoAI, apo-CIII, and apoAIV but not apoAV in vivo; the entire cluster has roles in regulating lipid metabolism
15642486 Observational study of gene-disease association. (HuGE Navigator)
15642486 positive association of apoCIII level with microvascular complications of Type 1 diabetes
15598690 Observational study of gene-disease association. (HuGE Navigator)
15598690 This study evaluates in Asian-Indians the association between these polymorphisms with metabolic syndrome and dyslipidemia
15585206 Observational study of gene-disease association. (HuGE Navigator)
15576429 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15549499 Observational study of genotype prevalence. (HuGE Navigator)
15542401 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15488874 Observational study of gene-disease association. (HuGE Navigator)
15375785 Observational study of gene-disease association. (HuGE Navigator)
15375785 elevated apoCIII concentration was associated with risk factors for cardiovascular disease in normolipidemic type 1 diabetic patients
15364160 Observational study of gene-disease association. (HuGE Navigator)
15364160 apo C III is an independent risk factor for atherosclerotic diseases in Chinese type 2 diabetes.
15304365 Human apoA-I/C-III/A-IV transgenic rabbits may provide a reliable model for studies of the transcriptional regulation of the cluster, and for evaluating the effects of different agents on the expression of the three genes.
15292332 Increased hepatic production of VLDL apoC-III may be characteristic of subjects with higher body weights and lower levels of insulin sensitivity and is strongly related to plasma concentration and level of production of VLDL TG.
15175273 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15161788 Atorvastatin treatment resulted in a significant dose-dependent reduction in plasma apoC-III in patients with type 2 diabetes.
15151505 Observational study of gene-disease association. (HuGE Navigator)
15124908 Observational study of gene-disease association. (HuGE Navigator)
15124908 S2 allele -- a susceptibility marker for high triglycerides levels
15117734 APOA5 and APOC3 independently influence plasma triglyceride concentrations but in an opposing manner.
15076187 Observational study of gene-disease association. (HuGE Navigator)
15076187 APOC3, LPL and GpIIIa genes were found to be associated with BP levels. The contributions of these genes, although modest, are consistent with the polygenic nature of blood pressure levels.
15039125 Observational study of gene-disease association. (HuGE Navigator)
15019539 Observational study of gene-disease association. (HuGE Navigator)
14650351 Observational study of gene-disease association. (HuGE Navigator)
14612212 Observational study of gene-disease association. (HuGE Navigator)
14569462 evidence for a pleiotropic effect between HDL, HDL3 and triglycerides at the APOC3 locus
14563827 Observational study of gene-disease association. (HuGE Navigator)
14563827 apoC-III-rich lipoprotein metabolism and the APOC3 polymorphism have relevant impacts on the coronary artery disease risk of metabolic syndrome patents
14517726 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14517726 associations between the apolipoprotein CIII polymorphism and triacylglycerol concentrations in fasting and postprandial plasma
12964943 Observational study of gene-disease association. (HuGE Navigator)
12962772 Observational study of gene-disease association. (HuGE Navigator)
12782148 APOC3 worked as LPL-inhibitor of the lipolysis activated by APOC2. The binding density of APOC3 was less for small emulsion surfaces than for large ones.
12754559 Observational study of gene-disease association. (HuGE Navigator)
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12697301 Observational study of gene-disease association. (HuGE Navigator)
12692252 Hepatitis B virus (HBV) reduced steady-state levels of apolipoprotein 3 mRNAs in two hepatoma cell lines
12691171 Clinical trial of gene-environment interaction. (HuGE Navigator)
12676816 Observational study of gene-disease association. (HuGE Navigator)
12600077 Observational study of gene-disease association. (HuGE Navigator)
12588953 Observational study of gene-disease association. (HuGE Navigator)
12556235 Observational study of gene-disease association. (HuGE Navigator)
12514935 Observational study of gene-disease association. (HuGE Navigator)
12417525 Observational study of gene-disease association. (HuGE Navigator)
12401896 ApoC-III is associated with binding to the vascular proteoglycan biglycan
12235176 Observational study of gene-disease association. (HuGE Navigator)
12235176 homozygosity for a ApoC-III gene polymorphism was associated with a significantly increased risk of coronary artery disease, suggesting that it represents an independent genetic susceptibility factor for CAD
12189450 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12189450 SstI polymorphism is associated with insulin sensitivity in young men but not in women
12176399 Observational study of gene-disease association. (HuGE Navigator)
12176399 In a group of healthy adults, this polymorphism was associated with circulating triglycerides, with 55% lower fasting levels in the homozygous wild-type (TT) compared to the homozygous rare allele (GG) genotype.
12118856 Observational study of gene-disease association. (HuGE Navigator)
12118856 Apolipoprotein C-III and E polymorphisms and cardiovascular syndrome, hyperlipidemia, and insulin resistance in renal transplantation
12116231 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12082170 The lipid-interacting properties of the N-terminal domain of human apolipoprotein C-III (apo C-III) were investigated
12052247 Observational study of gene-disease association. (HuGE Navigator)
12052247 Study shows a significant association between rare S2 allele of APOC3 and hypertriglyceridemia in Asian Indians.
12048138 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12048121 Observational study of gene-disease association. (HuGE Navigator)
11959336 Observational study of gene-disease association. (HuGE Navigator)
11903304 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11893778 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11840804 Observational study of gene-disease association. (HuGE Navigator)
11839757 activation of promoter by upstream stimulatory factor and hepatic nuclear factor-4 in presence of initiator-like elements
11837227 Observational study of gene-environment interaction. (HuGE Navigator)
11740190 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11737222 Observational study of gene-disease association. (HuGE Navigator)
11714857 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11575217 Observational study of gene-disease association. (HuGE Navigator)
11572515 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11533368 Observational study of gene-disease association. (HuGE Navigator)
11512679 Observational study of genotype prevalence. (HuGE Navigator)
11500189 Observational study of gene-disease association. (HuGE Navigator)
11472750 Observational study of gene-disease association. (HuGE Navigator)
11443500 Observational study of gene-disease association. (HuGE Navigator)
11427182 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11359462 Observational study of gene-disease association. (HuGE Navigator)
11341749 Observational study of genotype prevalence. (HuGE Navigator)
11284423 Observational study of gene-disease association. (HuGE Navigator)
11270684 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11193221 Observational study of gene-disease association. (HuGE Navigator)
11181747 Observational study of gene-disease association. (HuGE Navigator)
11171287 Observational study of gene-disease association. (HuGE Navigator)
11152845 Observational study of gene-disease association. (HuGE Navigator)
11126401 Observational study of gene-disease association. (HuGE Navigator)
11116069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL      1 - 70
KDYWSTVKDKFSEFWDLDPEVRPTSAVAA                                              71 - 99
//

Text Mined References (358)

PMID Year Title
26996551 2016 Apolipoproteins as Differentiating and Predictive Markers for Assessing Clinical Outcomes in Patients with Small Cell Lung Cancer.
26790392 2016 D25V apolipoprotein C-III variant causes dominant hereditary systemic amyloidosis and confers cardiovascular protective lipoprotein profile.
26782469 2015 APOA5 -1131T>C and APOC3 -455T>C polymorphisms are associated with an increased risk of coronary heart disease.
26625519 2015 [An Association Between T455C Polymorphism of Apolipoprotein C-III Gene, Insulin Resistance and Metabolic Syndrome Components].
26516010 2015 Association of APOC3 Loss-of-Function Mutations With Plasma Lipids and Subclinical Atherosclerosis: The Multi-Ethnic BioImage Study.
26491253 2015 Decreased expression of the APOA1-APOC3-APOA4 gene cluster is associated with risk of Alzheimer's disease.
26485402 2015 Transcriptome Reveals 1400-Fold Upregulation of APOA4-APOC3 and 1100-Fold Downregulation of GIF in the Patients with Polycythemia-Induced Gastric Injury.
26452348 2015 The association of HDL-apoCIII with coronary heart disease and the effect of statin treatment on it.
26387083 2015 Apolipoprotein A5 and apolipoprotein C3 single nucleotide polymorphisms are correlated with an increased risk of coronary heart disease: a case-control and meta-analysis study.
26301570 2015 Tryptophan probes reveal residue-specific phospholipid interactions of apolipoprotein C-III.
26247234 2015 Apolipoprotein C3 Gene Variants and Risk of Developing Type 2 Diabetes in Saudi Subjects.
26228667 The risk of cardiovascular events with increased apolipoprotein CIII: A systematic review and meta-analysis.
26117401 2015 Lipoprotein associated phospholipase A2 activity, apolipoprotein C3 loss-of-function variants and cardiovascular disease: The Atherosclerosis Risk In Communities Study.
26069232 2015 Plasma apolipoprotein C-III levels, triglycerides, and coronary artery calcification in type 2 diabetics.
25994465 2015 [Mutations of APOC3 gene, metabolism of triglycerides and reduction of ischemic cardiovascular events].
25994187 2015 Effect of apolipoprotein C3 genetic polymorphisms on serum lipid levels and the risk of intracerebral hemorrhage.
25979856 2015 An experimental study on amelioration of dyslipidemia-induced atherosclesis by Clematichinenoside through regulating Peroxisome proliferator-activated receptor-? mediated apolipoprotein A-I, A-II and C-III.
25928461 2015 Associations of the APOC3 rs5128 polymorphism with plasma APOC3 and lipid levels: a meta-analysis.
25653052 2015 Dietary patterns interact with APOA1/APOC3 polymorphisms to alter the risk of the metabolic syndrome: the Tehran Lipid and Glucose Study.
25641685 2015 MALDI-TOF MS applied to apoC-III glycoforms of patients with congenital disorders affecting O-glycosylation. Comparison with two-dimensional electrophoresis.
25463085 2014 Tissue-specific DNA methylation profiles regulate liver-specific expression of the APOA1/C3/A4/A5 cluster and can be manipulated with demethylating agents on intestinal cells.
25380998 2014 Apolipoprotein C3 genetic polymorphisms are associated with lipids and coronary artery disease in a Chinese population.
25363704 2014 Rare variant APOC3 R19X is associated with cardio-protective profiles in a diverse population-based survey as part of the Epidemiologic Architecture for Genes Linked to Environment Study.
25320541 2014 Apolipoprotein C3 (-455T>C) polymorphism confers susceptibility to nonalcoholic fatty liver disease in the Southern Han Chinese population.
25319715 2014 Apolipoprotein C3 gene polymorphisms in Southern Indian patients with nonalcoholic fatty liver disease.
25301527 2014 Western dietary pattern interaction with APOC3 polymorphism in the risk of metabolic syndrome: Tehran Lipid and Glucose Study.
24972136 2014 Genetic variants of APOC3 promoter and HLA-B genes in an HIV infected cohort in northern South Africa: a pilot study.
24966274 2014 Obesity favors apolipoprotein E- and C-III-containing high density lipoprotein subfractions associated with risk of heart disease.
24941082 2014 Loss-of-function mutations in APOC3 and risk of ischemic vascular disease.
24941081 2014 Loss-of-function mutations in APOC3, triglycerides, and coronary disease.
24707151 2014 Lack of association between apolipoprotein C3 gene polymorphisms and risk of nonalcoholic fatty liver disease in a Chinese Han population.
24685634 2014 Apolipoprotein C-III is an amyloid-?-binding protein and an early marker for Alzheimer's disease.
24430880 2014 Association between apolipoprotein C3 Sst I, T-455C, C-482T and C1100T polymorphisms and risk of coronary heart disease.
24386095 2013 A genome wide association study identifies common variants associated with lipid levels in the Chinese population.
24343240 2013 A rare functional cardioprotective APOC3 variant has risen in frequency in distinct population isolates.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24242684 2013 Factor II activity is similarly increased in patients with elevated apolipoprotein CIII and in carriers of the factor II 20210A allele.
24211975 2014 Transcriptional suppression of human apolipoproteinA4 and apolipoproteinC3 genes by phorbol myristate acetate in hepatic and intestinal cells.
24121499 2013 Apolipoproteins C-I and C-III inhibit lipoprotein lipase activity by displacement of the enzyme from lipid droplets.
23808989 2013 Abdominal fat interacts with PNPLA3 I148M, but not with the APOC3 variant in the pathogenesis of liver steatosis in chronic hepatitis C.
23804528 2013 Genetic and clinical markers of elevated liver fat content in overweight and obese Hispanic children.
23701270 2014 Two novel mutations in apolipoprotein C3 underlie atheroprotective lipid profiles in families.
23631828 2013 Identification of potential bladder cancer markers in urine by abundant-protein depletion coupled with quantitative proteomics.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23527852 2013 Identification of new apolipoprotein-CIII glycoforms with ultrahigh resolution MALDI-FTICR mass spectrometry of human sera.
23512881 2013 A gene variant of PNPLA3, but not of APOC3, is associated with histological parameters of NAFLD in an obese population.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
23377670 2013 Synergistic effect between lipoprotein lipase and apolipoprotein C3 genes in determining the severity of coronary artery disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23173569 2012 Identification of the HDL-ApoCIII to VLDL-ApoCIII ratio as a predictor of coronary artery disease in the general population: the Chin-Shan Community Cardiovascular Cohort (CCCC) study in Taiwan.
22924697 2013 Interactions between the apolipoprotein a1/c3/a5 haplotypes and alcohol consumption on serum lipid levels.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22848358 2012 Hypercholesterolemia is associated with the apolipoprotein C-III (APOC3) genotype in children receiving HAART: an eight-year retrospective study.
22675253 2012 Associations of polymorphisms in the apolipoprotein APOA1-C3-A5 gene cluster with acute coronary syndrome.
22510806 2012 Apolipoprotein C-III and hepatic triglyceride-rich lipoprotein production.
22301884 2012 Antisense inhibition of apoB synthesis with mipomersen reduces plasma apoC-III and apoC-III-containing lipoproteins.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22211242 2012 Females with angina pectoris have altered lipoprotein metabolism with elevated cholesteryl ester transfer protein activity and impaired high-density lipoproteins-associated antioxidant enzymes.
22197810 2012 Mdm2 is a novel activator of ApoCIII promoter which is antagonized by p53 and SHP inhibition.
22141340 2012 Genetic variation in PNPLA3 but not APOC3 influences liver fat in non-alcoholic fatty liver disease.
22101237 2012 Identification of proteomic biomarkers in maternal plasma in the early second trimester that predict the subsequent development of gestational diabetes.
22054125 2011 Lack of association between apolipoprotein C3 gene polymorphisms and risk of coronary heart disease in a Han population in East China.
22023023 2012 Characterization of a hypertriglyceridemic transgenic miniature pig model expressing human apolipoprotein CIII.
22004016 2011 Gender- and obesity-specific effect of apolipoprotein C3 gene (APOC3) -482C>T polymorphism on triglyceride concentration in Turkish adults.
21986282 2011 Low-density lipoproteins containing apolipoprotein C-III and the risk of coronary heart disease.
21939545 2011 Antiretroviral treatment-induced dyslipidemia in HIV-infected patients is influenced by the APOC3-related rs10892151 polymorphism.
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
21854571 2011 Apolipoprotein A1/C3/A5 haplotypes and serum lipid levels.
21829161 2012 Visceral obesity modulates the impact of apolipoprotein C3 gene variants on liver fat content.
21777557 2011 The APOC3 T-455C and C-482T promoter region polymorphisms are not associated with the severity of liver damage independently of PNPLA3 I148M genotype in patients with nonalcoholic fatty liver.
21767760 2011 Association of a DNA polymorphism of the apolipoprotein AI-CIII-AIV gene cluster with myocardial infarction in a Tunisian population.
21676879 2011 Missense mutation in APOC3 within the C-terminal lipid binding domain of human ApoC-III results in impaired assembly and secretion of triacylglycerol-rich very low density lipoproteins: evidence that ApoC-III plays a major role in the formation of lipid precursors within the microsomal lumen.
21663607 2011 Lack of effect of apolipoprotein C3 polymorphisms on indices of liver steatosis, lipid profile and insulin resistance in obese Southern Europeans.
21646779 2011 Elevated levels of triglyceride and triglyceride-rich lipoprotein triglyceride induced by a high-carbohydrate diet is associated with polymorphisms of APOA5-1131T>C and APOC3-482C>T in Chinese healthy young adults.
21603779 2011 A high-carbohydrate diet enhances the adverse effect of the S2 allele of APOC3 SstI polymorphism on the TG/HDL-C ratio only in young Chinese females.
21499891 2011 Association of lipoprotein lipase and apolipoprotein C-III genes polymorphism with acute myocardial infarction in diabetic patients.
21421846 2011 Complexities of plasma apolipoprotein C-III metabolism.
21378990 2011 Large-scale association analysis identifies 13 new susceptibility loci for coronary artery disease.
21373834 2011 Association of an APOC3 promoter variant with type 2 diabetes risk and need for insulin treatment in lean persons.
21321243 2011 Elevated ratio of maternal plasma ApoCIII to ApoCII in preeclampsia.
21297177 2011 Plasma apolipoprotein C-III metabolism in patients with chronic kidney disease.
21274868 2011 Dissociation between APOC3 variants, hepatic triglyceride content and insulin resistance.
21269460 2011 Initial characterization of the human central proteome.
21267442 2011 Serum apolipoproteins C-I and C-III are reduced in stomach cancer patients: results from MALDI-based peptidome and immuno-based clinical assays.
21185820 2011 APOC3 -482C>T polymorphism, circulating apolipoprotein C-III and smoking: interrelation and roles in predicting type-2 diabetes and coronary disease.
21183731 2011 Transcriptional activation of apolipoprotein CIII expression by glucose may contribute to diabetic dyslipidemia.
21080234 2011 Presence of apolipoprotein C-III attenuates apolipoprotein E-mediated cellular uptake of cholesterol-containing lipid particles by HepG2 cells.
21033077 2010 [Correlation of metabolic syndrome clinical signs and genetic determinants at children with obese].
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20855565 2010 Common genetic variation in multiple metabolic pathways influences susceptibility to low HDL-cholesterol and coronary heart disease.
20727869 2010 Effect of apolipoprotein C3 and apolipoprotein A1 polymorphisms on postprandial response to a fat overload in metabolic syndrome patients.
20716347 2010 Interactions of the apolipoprotein C-III 3238C>G polymorphism and alcohol consumption on serum triglyceride levels.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20674306 2011 The APOA1/C3/A4/A5 cluster and markers of allostatic load in the Boston Puerto Rican Health Study.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20517165 2010 Apolipoprotein C-III gene polymorphism and several environmental factors with serum lipid levels in the Guangxi Hei Yi Zhuang and Han populations.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20368524 2010 Apolipoprotein C-III and the metabolic basis for hypertriglyceridemia and the dense low-density lipoprotein phenotype.
20335584 2010 Apolipoprotein C3 gene variants in nonalcoholic fatty liver disease.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20303494 2010 Apolipoprotein CIII bound to apoB-containing lipoproteins is associated with small, dense LDL independent of plasma triglyceride levels in healthy men.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20097930 2010 Functional analysis of the missense APOC3 mutation Ala23Thr associated with human hypotriglyceridemia.
20071361 2010 Mass spectrometric identification of aberrantly glycosylated human apolipoprotein C-III peptides in urine from Schistosoma mansoni-infected individuals.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
20002542 2010 Apolipoprotein C-III predicts cardiovascular mortality in severe coronary artery disease and is associated with an enhanced plasma thrombin generation.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19932084 2010 Association of APOA5 and APOC3 gene polymorphisms with plasma apolipoprotein A5 level in patients with metabolic syndrome.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910636 2010 Metabolism of very-low-density lipoprotein and low-density lipoprotein containing apolipoprotein C-III and not other small apolipoproteins.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19785722 2009 Discovery and identification of potential biomarkers of papillary thyroid carcinoma.
19732897 2010 Associations of polymorphisms in the apolipoprotein A1/C3/A4/A5 gene cluster with familial combined hyperlipidaemia in Hong Kong Chinese.
19701693 2010 Genetic variants on apolipoprotein gene cluster influence triglycerides with a risk of coronary artery disease among Indians.
19689828 2009 Nutrigenetics: links between genetic background and response to Mediterranean-type diets.
19656773 2009 A polygenic basis for four classical Fredrickson hyperlipoproteinemia phenotypes that are characterized by hypertriglyceridemia.
19622837 2010 Expression of apolipoprotein C-III in McA-RH7777 cells enhances VLDL assembly and secretion under lipid-rich conditions.
19592705 2010 Effects of variations in the APOA1/C3/A4/A5 gene cluster on different parameters of postprandial lipid metabolism in healthy young men.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19534808 2009 Lipoprotein lipase activity and mass, apolipoprotein C-II mass and polymorphisms of apolipoproteins E and A5 in subjects with prior acute hypertriglyceridaemic pancreatitis.
19502413 2009 ApoCIII-enriched LDL in type 2 diabetes displays altered lipid composition, increased susceptibility for sphingomyelinase, and increased binding to biglycan.
19501493 2010 A composite scoring of genotypes discriminates coronary heart disease risk beyond conventional risk factors in the Boston Puerto Rican Health Study.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19424489 2009 Apolipoprotein C3 polymorphisms, cognitive function and diabetes in Caribbean origin Hispanics.
19403283 2010 APOE, CETP and LPL genes show strong association with lipid levels in Greek children.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19322776 2009 Targeted serum glycoproteomics for the discovery of lung cancer-associated glycosylation disorders using lectin-coupled ProteinChip arrays.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19207029 2009 Common sequence variant in lipoprotein lipase gene conferring triglyceride response to fibrate treatment.
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19074352 2008 A null mutation in human APOC3 confers a favorable plasma lipid profile and apparent cardioprotection.
19060911 2009 Loci influencing lipid levels and coronary heart disease risk in 16 European population cohorts.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19057464 2009 Pharmacogenetic association of the APOA1/C3/A4/A5 gene cluster and lipid responses to fenofibrate: the genetics of lipid-lowering drugs and diet network study.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
19034316 2009 The expression of type III hyperlipoproteinemia: involvement of lipolysis genes.
19000312 2008 Birth weight and blood lipid levels in Spanish adolescents: influence of selected APOE, APOC3 and PPARgamma2 gene polymorphisms. The AVENA Study.
18835943 2009 Plasma apolipoprotein CI and CIII levels are associated with increased plasma triglyceride levels and decreased fat mass in men with the metabolic syndrome.
18823627 2009 Association of lipoprotein lipase D9N polymorphism with myocardial infarction in type 2 diabetes: the genetics, outcomes, and lipids in type 2 diabetes (GOLD) study.
18801202 2008 Genetic studies on the APOA1-C3-A5 gene cluster in Asian Indians with premature coronary artery disease.
18789138 2008 The APOA5 Trp19 allele is associated with metabolic syndrome via its association with plasma triglycerides.
18767813 2008 ABCA1 promotes the de novo biogenesis of apolipoprotein CIII-containing HDL particles in vivo and modulates the severity of apolipoprotein CIII-induced hypertriglyceridemia.
18753860 2008 Genetic polymorphisms differently influencing the emergence of atrophy and fat accumulation in HIV-related lipodystrophy.
18678879 2008 The apolipoprotein CIII enhancer regulates both extensive histone modification and intergenic transcription of human apolipoprotein AI/CIII/AIV genes but not apolipoprotein AV.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18635818 2008 Effects of six APOA5 variants, identified in patients with severe hypertriglyceridemia, on in vitro lipoprotein lipase activity and receptor binding.
18566295 2008 Atorvastatin and fenofibrate have comparable effects on VLDL-apolipoprotein C-III kinetics in men with the metabolic syndrome.
18560672 2008 Apolipoprotein CIII polymorphism and triglyceride levels of a Japanese population living in Southern Brazil.
18556566 2008 Triglyceride-rich lipoprotein-associated apolipoprotein C-III production is stimulated by plasma free fatty acids in humans.
18541587 2008 Abdominal obesity and hyperglycemia mask the effect of a common APOC3 haplotype on the risk of myocardial infarction.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18509206 2008 Dose-dependent effect of rosuvastatin on VLDL-apolipoprotein C-III kinetics in the metabolic syndrome.
18408013 2008 Structure and dynamics of human apolipoprotein CIII.
18399797 2008 Apolipoprotein C-III: understanding an emerging cardiovascular risk factor.
18289550 2008 Synergistic effects of the apolipoprotein E epsilon3/epsilon2/epsilon4, the cholesteryl ester transfer protein TaqIB, and the apolipoprotein C3 -482 C>T polymorphisms on their association with coronary artery disease.
18274205 2007 Common variants APOC3, APOA5, APOE and PON1 are associated with variation in plasma lipoprotein traits in Greenlanders.
18240956 2008 Association of APOC3 polymorphisms with both dyslipidemia and lipoatrophy in HAART-receiving patients.
18206649 2008 APOA1/C3/A5 haplotype and risk of hypertriglyceridemia in Taiwanese.
18201179 2008 An ABC of apolipoprotein C-III: a clinically useful new cardiovascular risk factor?
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18188530 2007 ApoE epsilon2/epsilon3/epsilon4 polymorphism, ApoC-III/ApoE ratio and metabolic syndrome.
18187430 2007 The lipoprotein lipase serine 447 stop polymorphism is associated with altered serum carotenoid concentrations in the Stanislas Family Study.
18179892 2008 Genome-wide association study identifies genes for biomarkers of cardiovascular disease: serum urate and dyslipidemia.
18096054 2007 Association between the -455T>C promoter polymorphism of the APOC3 gene and the metabolic syndrome in a multi-ethnic sample.
18034366 2008 Lack of replication of genetic associations with human longevity.
18020971 2008 Genetic profiling in healthy subjects from the Stanislas cohort based on 24 polymorphisms: effects on biological variables.
17996965 2008 The orphan nuclear receptor Rev-erbbeta recruits Tip60 and HDAC1 to regulate apolipoprotein CIII promoter.
17964293 2008 Genetic association study of APOA1/C3/A4/A5 gene cluster and haplotypes on triglyceride and HDL cholesterol in a community-based population.
17957542 2007 Serum protein oxidation and apolipoprotein CIII levels in people with systemic lupus erythematosus with and without nephritis.
17919884 2007 Prediction of genetic risk for dyslipidemia.
17885207 2008 Nuclear receptor hepatocyte nuclear factor 4alpha1 competes with oncoprotein c-Myc for control of the p21/WAF1 promoter.
17855807 2007 Maternal and fetal variation in genes of cholesterol metabolism is associated with preterm delivery.
17853951 2007 Association of apolipoprotein A1-C3 gene cluster polymorphisms with gallstone disease.
17825930 2008 A novel haplotype in ApoAI-CIII-AIV gene region is detrimental to Northwest Indians with coronary heart disease.
17726453 2008 Allelic variation in ApoC3, ApoA5 and LPL genes and first and second generation antipsychotic effects on serum lipids in patients with schizophrenia.
17700364 2007 Contribution of 20 single nucleotide polymorphisms of 13 genes to dyslipidemia associated with antiretroviral therapy.
17672999 2007 [Relation between apolipoprotein CIII gene polymorphism and coronary artery disease].
17654446 2007 The ApoAI-CIII-AIV gene cluster and its relation to lipid levels in type 2 diabetes mellitus and coronary heart disease: determination of a novel susceptible haplotype.
17615573 2007 Analysis of multiple SNPs in genetic association studies: comparison of three multi-locus methods to prioritize and select SNPs.
17457002 2007 Apolipoprotein A-I/C-III/A-IV SstI and apolipoprotein B XbaI polymorphisms do not affect early functional and structural changes in atherosclerosis: the Cardiovascular Risk in Young Finns study.
17438339 2007 Effects of apoA-V on HDL and VLDL metabolism in APOC3 transgenic mice.
17416293 2007 APOC3 promoter polymorphisms C-482T and T-455C are associated with the metabolic syndrome.
17378725 2007 Polymorphisms in the APOA1/C3/A4/A5 gene cluster and cholesterol responsiveness to dietary change.
17367769 2007 Association between plasma lipid parameters and APOC3 genotypes in Brazilian subjects: effect of gender, smoking and APOE genotypes.
17342071 2007 Genetic epistasis in the VLDL catabolic pathway is associated with deleterious variations on triglyceridemia in obese subjects.
17336988 2007 Fractionation of cholesteryl ester rich intermediate density lipoprotein subpopulations by chondroitin sulphate.
17318300 2007 The combination of ApoCIII, hepatic lipase and hormono sensitive lipase gene polymorphisms suggests an association with susceptibility to gestational hypertension.
17314277 2007 Rapid turnover of apolipoprotein C-III-containing triglyceride-rich lipoproteins contributing to the formation of LDL subfractions.
17283453 Polymorphism in apoprotein-CIII gene and coronary heart disease.
17261136 2007 Apolipoprotein AI-CIII-AIV gene cluster polymorphisms in relation to cholesterol gallstone.
17197160 2007 The effect of APOA5 and APOC3 variants on lipid parameters in European Whites, Indian Asians and Afro-Caribbeans with type 2 diabetes.
17154273 2007 Proteomic analysis of human very low-density lipoprotein by two-dimensional gel electrophoresis and MALDI-TOF/TOF.
17142127 2006 Longitudinal analysis of haplotypes and polymorphisms of the APOA5 and APOC3 genes associated with variation in serum triglyceride levels: the Bogalusa Heart Study.
17038637 2007 Apolipoprotein CIII-induced THP-1 cell adhesion to endothelial cells involves pertussis toxin-sensitive G protein- and protein kinase C alpha-mediated nuclear factor-kappaB activation.
17032446 2006 Triglyceride associated polymorphisms of the APOA5 gene have very different allele frequencies in Pune, India compared to Europeans.
17020471 2006 Different genes and polymorphisms affecting high-density lipoprotein cholesterol levels in Greek familial hypercholesterolemia patients.
17016614 2006 Genetic factors for obesity.
16973241 2007 Convergence of genes implicated in Alzheimer's disease on the cerebral cholesterol shuttle: APP, cholesterol, lipoproteins, and atherosclerosis.
16968945 2006 Functionally defective high-density lipoprotein: a new therapeutic target at the crossroads of dyslipidemia, inflammation, and atherosclerosis.
16935699 2006 Apolipoprotein E enrichment of immuno-separated chylomicron and chylomicron remnants following saturated fatty acids.
16917759 2006 The apolipoprotein A-V genotype and plasma apolipoprotein A-V and triglyceride levels: prospective risk of type 2 diabetes. Results from the Northwick Park Heart Study II.
16864937 2006 Effect of SstI polymorphism of the apolipoprotein CIII gene and environmental factors on risks of hypertriglyceridemia in Taiwan aborigines.
16861622 2006 Evidence for a complex relationship between apoA-V and apoC-III in patients with severe hypertriglyceridemia.
16813599 2006 Association of lipoprotein lipase S447X, apolipoprotein E exon 4, and apoC3 -455T>C polymorphisms on the susceptibility to diabetic nephropathy.
16781717 2007 Associations of the apolipoprotein A1/C3/A4/A5 gene cluster with triglyceride and HDL cholesterol levels in women with type 2 diabetes.
16769999 2006 Apolipoprotein A-V, triglycerides and risk of coronary artery disease: the prospective Epic-Norfolk Population Study.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16710093 2006 Evidence for consistent intragenic and intergenic interactions between SNP effects in the APOA1/C3/A4/A5 gene cluster.
16705465 2006 The contribution of individual and pairwise combinations of SNPs in the APOA1 and APOC3 genes to interindividual HDL-C variability.
16702309 2006 Plasma triglyceride and HDL-cholesterol concentrations in Vietnamese girls are affected by lipoprotein lipase, but not apolipoprotein CIII polymorphism.
16682041 2007 The -1131 T>C and S19W APOA5 gene polymorphisms are associated with high levels of triglycerides and apolipoprotein C-III, but not with coronary artery disease: an angiographic study.
16602826 2006 Lipoprotein genotype and conserved pathway for exceptional longevity in humans.
16505251 2006 Susceptibility to type 1 diabetes is associated with ApoCIII gene haplotypes.
16495512 2006 Apolipoprotein C-III isoforms: kinetics and relative implication in lipid metabolism.
16443932 2006 Apolipoprotein A-I activates Cdc42 signaling through the ABCA1 transporter.
16430904 2006 Association between well-characterized lipoprotein-related genetic variants and carotid intimal medial thickness and stenosis: The Framingham Heart Study.
16417409 2006 Associations among race/ethnicity, ApoC-III genotypes, and lipids in HIV-1-infected individuals on antiretroviral therapy.
16410456 2006 Apolipoproteins C-III and A-V as predictors of very-low-density lipoprotein triglyceride and apolipoprotein B-100 kinetics.
16343038 2006 Effect of gene polymorphisms on lipoprotein levels in patients with dyslipidemia of metabolic syndrome.
16326171 2006 Associations between plasma lipid parameters and APOC3 and APOA4 genotypes in a healthy population are independent of dietary cholesterol intake.
16321685 2006 Impact of APOA5/A4/C3 genetic polymorphisms on lipid variables and cardiovascular disease risk in French men.
16276364 2006 Clinical and genetic associations with hypertriglyceridemic waist in a Canadian aboriginal population.
16205020 2005 Polymorphisms in four genes related to triglyceride and HDL-cholesterol levels in the general Japanese population in 2000.
16192625 2005 APOC3/A5 haplotypes, lipid levels, and risk of myocardial infarction in the Central Valley of Costa Rica.
16136540 Apolipoproteins (apoproteins) and LPL variation in Mennonite populations of Kansas and Nebraska.
16030523 2005 Genetic determinants of plasma HDL-cholesterol levels in familial hypercholesterolemia.
16015281 2005 Effect of the APOC3 Sst I SNP on fasting triglyceride levels in men heterozygous for the LPL P207L deficiency.
15983323 2005 Effect of hepatic lipase -514C->T polymorphism and its interactions with apolipoprotein C3 -482C->T and apolipoprotein E exon 4 polymorphisms on the risk of nephropathy in chinese type 2 diabetic patients.
15962178 2005 APOA1/C3/A4 gene cluster variability and lipid levels in Brazilian children.
15949705 2005 Interaction between insulin (VNTR) and hepatic lipase (LIPC-514C>T) variants on the response to an oral glucose tolerance test in the EARSII group of young healthy men.
15924804 2005 [Polymorphisms in the apolipoprotein A5 gene and apolipoprotein C3 gene in patients with coronary artery disease].
15910632 2005 Association between MspI polymorphism of the APO AI gene and Type 2 diabetes mellitus.
15868628 2005 Response to a urate-lowering diet according to polymorphisms in the apolipoprotein AI-CIII-AIV cluster.
15864534 2005 Alterations of lipids and apolipoprotein CIII in very low density lipoprotein subspecies in type 2 diabetes.
15862889 2005 The APOC3 SstI polymorphism is weakly associated with sporadic Alzheimer's disease in a Chinese population.
15823278 2005 Apolipoprotein A-I/C-III/A-IV SstI and apolipoprotein B XbaI polymorphisms and their association with carotid artery intima-media thickness in the Finnish population. The Cardiovascular Risk in Young Finns Study.
15809899 2005 Modeling the influence of APOC3, APOE, and TNF polymorphisms on the risk of antiretroviral therapy-associated lipid disorders.
15778093 2005 Apolipoproteins C-II and C-III inhibit selective uptake of low- and high-density lipoprotein cholesteryl esters in HepG2 cells.
15764642 2005 Additive effects of the PPARgamma, APOE, and FABP-2 genes in increasing daylong triglycerides of normolipidemic women to concentrations comparable to those in men.
15715433 2005 Association of Sst I polymorphism in apolipoprotein C3 gene with hypertriglyceridaemia in coronary atherosclerotic heart disease and type II diabetes mellitus in Chinese population.
15657615 2005 Polymorphisms in APOA1 and LPL genes are statistically independently associated with fasting TG in men with CAD.
15649902 2005 The expression of intact and mutant human apoAI/CIII/AIV/AV gene cluster in transgenic mice.
15642486 Apolipoprotein C-III protein concentrations and gene polymorphisms in Type 1 diabetes: associations with microvascular disease complications in the DCCT/EDIC cohort.
15598690 2005 Polymorphisms in the fatty acid-binding protein 2 and apolipoprotein C-III genes are associated with the metabolic syndrome and dyslipidemia in a South Indian population.
15585206 2005 Relationship between gene polymorphisms and prevalence of myocardial infarction among diabetic and non-diabetic subjects.
15576844 2005 Severe hypertriglyceridemia in human APOC1 transgenic mice is caused by apoC-I-induced inhibition of LPL.
15576429 2005 Apolipoprotein C-III, n-3 polyunsaturated fatty acids, and "insulin-resistant" T-455C APOC3 gene polymorphism in heart disease patients: example of gene-diet interaction.
15549499 2004 Population prevalence of APOE, APOC3 and PPAR-alpha mutations associated to hypertriglyceridemia in French Canadians.
15542401 2004 A single nucleotide polymorphism -1131T>C in the apolipoprotein A5 gene is associated with an increased risk of coronary artery disease and alters triglyceride metabolism in Chinese.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488874 2004 A prospective study of the APOA1 XmnI and APOC3 SstI polymorphisms in the APOA1/C3/A4 gene cluster and risk of incident myocardial infarction in men.
15375785 2004 Apolipoprotein C-III protein concentrations and gene polymorphisms in type 1 diabetes: associations with lipoprotein subclasses.
15364160 2004 Association of serum apolipoprotein C III levels and apolipoprotein C III gene Sst I polymorphism with carotid intima-media thickness in Chinese type 2 diabetic patients.
15304365 2004 Human apoA-I/C-III/A-IV gene cluster transgenic rabbits: effects of a high-cholesterol diet.
15292332 2004 Rate of production of plasma and very-low-density lipoprotein (VLDL) apolipoprotein C-III is strongly related to the concentration and level of production of VLDL triglyceride in male subjects with different body weights and levels of insulin sensitivity.
15175273 2004 Variation in USF1 shows haplotype effects, gene : gene and gene : environment associations with glucose and lipid parameters in the European Atherosclerosis Research Study II.
15161788 2004 Atorvastatin decreases apolipoprotein C-III in apolipoprotein B-containing lipoprotein and HDL in type 2 diabetes: a potential mechanism to lower plasma triglycerides.
15151505 2004 Genetic effect of two polymorphisms in the apolipoprotein A5 gene and apolipoprotein C3 gene on serum lipids and lipoproteins levels in a Chinese population.
15124908 2004 Apolipoprotein C3 SstI polymorphism in the risk assessment of CAD.
15117734 2004 Analysis of apolipoprotein A5, c3, and plasma triglyceride concentrations in genetically engineered mice.
15108119 2004 The effects of scale: variation in the APOA1/C3/A4/A5 gene cluster.
15076187 2004 Genetic influences on blood pressure within the Stanislas Cohort.
15039125 2004 Genotypes and haplotypes predisposing to myocardial infarction: a multilocus case-control study.
15019539 2004 Lipoprotein concentrations in newborns are associated with allelic variations in their mothers.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14650351 2003 Influence of polymorphism (RFLP-sstI) at the apolipoprotein C-III gene locus on the lipoprotein metabolism and insulin resistance in essential hypertensive patients. Interaction between gender and genetic polymorphism.
14612212 2003 Interaction between the APOC3 gene promoter polymorphisms, saturated fat intake and plasma lipoproteins.
14569462 2003 Evidence of linkage of HDL level variation to APOC3 in two samples with different ascertainment.
14563827 2003 Apolipoprotein C-III, metabolic syndrome, and risk of coronary artery disease.
14517726 2003 The apolipoprotein CIII T2854G variants are associated with postprandial triacylglycerol concentrations in normolipidemic Korean men.
12964943 2003 Genetic study of common variants at the Apo E, Apo AI, Apo CIII, Apo B, lipoprotein lipase (LPL) and hepatic lipase (LIPC) genes and coronary artery disease (CAD): variation in LIPC gene associates with clinical outcomes in patients with established CAD.
12962772 2003 Effect of apolipoprotein polymorphisms in renal transplant recipients.
12782148 2003 Effects of plasma apolipoproteins on lipoprotein lipase-mediated lipolysis of small and large lipid emulsions.
12754559 2003 Risk Factors, biochemical markers, and genetic polymorphisms in early coronary artery disease.
12732844 2003 A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus.
12697301 2003 Variants in the APOC3 promoter insulin responsive element modulate insulin secretion and lipids in middle-aged men.
12692252 2003 Hepatitis B virus-mediated changes of apolipoprotein mRNA abundance in cultured hepatoma cells.
12691171 2002 Genetic polymorphisms and lipoprotein responses to diets.
12676816 2003 Apolipoprotein AIV gene variant S347 is associated with increased risk of coronary heart disease and lower plasma apolipoprotein AIV levels.
12600077 2001 [Apolipoprotein C III gene Sst I polymorphism in patients with endogenous hypertriglyceridemia in Chinese population].
12588953 2003 Effect of apoC-III gene polymorphisms on the lipoprotein-lipid profile of viscerally obese men.
12556235 2003 The study of APOA1, APOC3 and APOA4 variability in healthy ageing people reveals another paradox in the oldest old subjects.
12514935 2002 Loci for CETP, LPL, LIPC, and APOC3 affect plasma lipoprotein size and sub-population distribution in Hispanic and non-Hispanic white subjects: the Columbia University BioMarkers Study.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417525 2002 Relative contribution of variation within the APOC3/A4/A5 gene cluster in determining plasma triglycerides.
12401896 2002 ApoC-III content of apoB-containing lipoproteins is associated with binding to the vascular proteoglycan biglycan.
12235176 2002 ApoC-III gene polymorphisms and risk of coronary artery disease.
12189450 2002 The SstI polymorphism of the apo C-III gene is associated with insulin sensitivity in young men.
12176399 2002 Influence of the APOC3 -2854T>G polymorphism on plasma lipid levels: effect of age and gender.
12118856 2002 Apolipoprotein C-III and E polymorphisms and cardiovascular syndrome, hyperlipidemia, and insulin resistance in renal transplantation.
12116231 2002 Candidate genes involved in cardiovascular risk factors by a family-based association study on the island of Kosrae, Federated States of Micronesia.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12082170 2002 Lipid-interacting properties of the N-terminal domain of human apolipoprotein C-III.
12052247 2002 Apolipoprotein C3 SstI polymorphism and triglyceride levels in Asian Indians.
12048138 2002 Genetic determinants of the response to bezafibrate treatment in the lower extremity arterial disease event reduction (LEADER) trial.
12048121 2002 Analysis of apolipoprotein A-I, lecithin:cholesterol acyltransferase and glucocerebrosidase genes in hypoalphalipoproteinemia.
11959336 2002 Association between the SstI polymorphism of the apolipoprotein C-III gene, glucose intolerance and cardiovascular risk in renal transplant recipients.
11903304 2001 Environmental and genetic determinants of intima-media thickness of the carotid artery.
11893778 2002 Associations of LPL and APOC3 gene polymorphisms on plasma lipids in a Mediterranean population: interaction with tobacco smoking and the APOE locus.
11840804 2001 [Apolipoprotein genes in patients with ischemic heart disease].
11837227 2001 Interaction between smoking and the Sstl polymorphism of the apo C-III gene determines plasma lipid response to diet.
11740190 2001 An interaction between apo C-III variants and protease inhibitors contributes to high triglyceride/low HDL levels in treated HIV patients.
11737222 2001 Two newly identified SNPs in the APO AI-CIII intergenic region are strongly associated with familial combined hyperlipidaemia.
11714857 2001 Genetic influences on lipid metabolism trait variability within the Stanislas Cohort.
11605014 2001 Reactivation of liver-specific gene expression in an immortalized human hepatocyte cell line by introduction of the human HNF4alpha2 gene.
11575217 2001 [APOC3, CETP, beta-fibrinogen and MTHFR are genetic determinants of carotid intim-media thickness (Stanislas cohort)].
11572515 Apolipoprotein AI and CIII gene polymorphisms and their association with lipid levels in Italian, Greek and Anglo-Irish populations of Australia.
11533368 2001 Age-related effects of genetic variation on lipid levels: The Columbia University BioMarkers Study.
11512679 2001 Allele frequencies for candidate genes in atherosclerosis and diabetes among Trinidadian neonates.
11500189 2001 Association of the Sst-I polymorphism at the APOC3 gene locus with variations in lipid levels, lipoprotein subclass profiles and coronary heart disease risk: the Framingham offspring study.
11472750 2001 Excess coronary heart disease in Familial Combined Hyperlipidemia, in relation to genetic factors and central obesity.
11443500 2001 Polymorphisms in the insulin response element of APOC-III gene promoter influence the correlation between insulin and triglycerides or triglyceride-rich lipoproteins in humans.
11427182 2001 Interaction of the common apolipoprotein C-III (APOC3 -482C > T) and hepatic lipase (LIPC -514C > T) promoter variants affects glucose tolerance in young adults. European Atherosclerosis Research Study II (EARS-II).
11359462 2001 APOC3, CETP, fibrinogen, and MTHFR are genetic determinants of carotid intima-media thickness in healthy men (the Stanislas cohort).
11341749 2001 Candidate gene polymorphisms in cardiovascular disease: a comparative study of frequencies between a French and an Italian population.
11284423 2001 [Polymorphisms in genes for cholesterol ester transfer protein, apolipoprotein C-III and lipoprotein lipase in children with high and low cholesterol levels] ].
11282888 2001 Gene expression patterns in the lungs of patients with primary pulmonary hypertension: a gene microarray analysis.
11270684 2001 Variable effects of the APOC3-482C > T variant on insulin, glucose and triglyceride concentrations in different ethnic groups.
11193221 2001 Age-associated accumulation of the apolipoprotein C-III gene T-455C polymorphism C allele in a Russian population.
11181747 2001 New genetic variants in the apoA-I and apoC-III genes and familial combined hyperlipidemia.
11171287 2001 Common genetic variants that relate to disorders of lipid transport in Spanish subjects with premature coronary artery disease.
11162594 2001 Apolipoprotein specificity for lipid efflux by the human ABCAI transporter.
11152845 2001 Prevalence of the APOC3 promoter polymorphisms T-455C and C-482T in Asian-Indians.
11126401 2000 Severe hypertriglyceridaemia in Type II diabetes: involvement of apoC-III Sst-I polymorphism, LPL mutations and apo E3 deficiency.
11116069 2000 Contribution of apolipoprotein C-III gene variants to determination of triglyceride levels and interaction with smoking in middle-aged men.
11060345 2000 Characterization of the lipid-binding properties and lipoprotein lipase inhibition of a novel apolipoprotein C-III variant Ala23Thr.
10870325 2000 DNA polymorphisms at the apolipoprotein A1-CIII loci in Taiwanese: correlation of plasma APOCIII with triglyceride level and body mass index.
9254056 1997 Apolipoproteins of HDL can directly mediate binding to the scavenger receptor SR-BI, an HDL receptor that mediates selective lipid uptake.
8245722 1993 Identification of disulfide-linked apolipoprotein species in human lipoproteins.
8099442 1993 An apolipoprotein CIII haplotype protective against hypertriglyceridemia is specified by promoter and 3' untranslated region polymorphisms.
6548954 1984 Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII.
6439535 1984 Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes.
6404278 1983 cDNA cloning of human apoA-I: amino acid sequence of preproapoA-I.
6328445 1984 Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.
6308458 1983 Linkage of human apolipoproteins A-I and C-III genes.
4846755 1974 The complete amino acid sequence of alanine apolipoprotein (apoC-3), and apolipoprotein from human plasma very low density lipoproteins.
4345202 1973 Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.
4066713 1985 Behavior of human apolipoprotein E in aqueous solutions and at interfaces.
4020294 1985 Inhibitory effects of C apolipoproteins from rats and humans on the uptake of triglyceride-rich lipoproteins and their remnants by the perfused rat liver.
3973011 1985 Modulation of lipoprotein lipase activity by apolipoproteins. Effect of apolipoprotein C-III.
3949020 1986 Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects.
3935800 1985 Comparison of the human apolipoprotein genes. Apo AII presents a unique functional intron-exon junction.
3931677 1985 Distribution of apolipoprotein A-I, C-II, C-III, and E mRNA in fetal human tissues. Time-dependent induction of apolipoprotein E mRNA by cultures of human monocyte-macrophages.
3931073 1985 Apolipoprotein multigene family: tandem organization of human apolipoprotein AI, CIII, and AIV genes.
3123586 1987 Molecular cloning of a human apoC-III variant: Thr 74----Ala 74 mutation prevents O-glycosylation.
3095836 1986 Structure, evolution, and polymorphisms of the human apolipoprotein A4 gene (APOA4).
2989400 1985 Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles.
2022742 1991 Apolipoprotein C-III(Lys58----Glu). Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia.
1917954 1991 Mechanisms of inhibition by apolipoprotein C of apolipoprotein E-dependent cellular metabolism of human triglyceride-rich lipoproteins through the low density lipoprotein receptor pathway.
182536 1976 Effect of serum and C-apoproteins from very low density lipoproteins on human postheparin plasma hepatic lipase.