Property Summary

NCBI Gene PubMed Count 113
PubMed Score 337.41
PubTator Score 329.94

Knowledge Summary

Patent

No data available

Expression

Gene RIF (59)

PMID Text
26196342 The results highlight the importance of charge-pair interactions within the apoC-II fibril core
26026161 Conformational rearrangement of apoC-II at lipoprotein surfaces promotes interaction with LPL.
25172036 Large deletion in APOC2 caused by Alu-Alu homologous recombination is associated with with apolipoprotein C-II deficiency.
25131724 No APOC2 mutations were identified in a cohort of patients with diabetic lipemia.
23631828 Six apolipoproteins (APOA1, APOA2, APOB, APOC2, APOC3, and APOE) were able to differentiate bladder cancer from hernia. SAA4 was significantly increased in bladder cancer subgroups, whereas ProEGF was significantly decreased in bladder cancer subgroups.
22808166 STAT1 bound on multienhancer 2 cooperates with RXRalpha located on apoCII promoter and upregulates apoCII expression only in macrophages.
22244853 Substoichiometric concentrations of cyc[60-70] significantly delayed fibril formation by the fibrillogenic, linear peptides apoC-II[60-70] and apoC-II[56-76].
22239554 Mutations in GPIHBP1 are rare but the associated clinical phenotype of hypertriglyceridaemia is severe
21985034 Activation of apoC-II fibrils by submicellar lipid (NBD-lyso-12-phosphocholine) is catalytic with release of monomer- and tetramer-bound lipid accompanying fibril elongation and growth.
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
21476595 Physiological shear flow conditions and conditions experienced during apoC-II manufacturing exert significant effects on apoC-II conformation, leading to protein misfolding, aggregation, and amyloid fibril formation.
21321243 These results support a predictive change in the ratio of plasma ApoCIII to ApoCII in pregnancies complicated by severe preeclampsia.
21146539 Our structural model for apoC-II fibrils suggests that apoC-II monomers fold and self-assemble to form a stable cross-beta-scaffold containing relatively unstructured connecting loops.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20498921 This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort.
20498921 Observational study of gene-disease association. (HuGE Navigator)
20430392 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20042600 Results describe the functional role of the secondary structure in the lipoprotein lipase-binding portion of apolipoprotein CII.
20031551 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19878569 Observational study of gene-disease association. (HuGE Navigator)
19534808 No significant differences were found between the acute hypertriglyceridaemic pancreatitis cases and controls with severe hypertriglyceridaemia in terms of LPL activity and mass, hepatic lipase activity, CII and CIII mass, or apo E polymorphisms.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19034041 Observational study of gene-disease association. (HuGE Navigator)
19014618 Observational study of gene-disease association. (HuGE Navigator)
18852267 lipids promote on-pathway intermediates of apoC-II fibril assembly and the accumulation of a discrete tetrameric intermediate depends on the molecular state of the lipid
18660489 Observational study of gene-disease association. (HuGE Navigator)
18206908 The concentration-dependent kinetics of apolipoprotein C-II amyloid fibril formation and correlated this with the final size distribution of the fibrils determined by sedimentation velocity experiments, is studied.
18005990 Phospholipid interaction induces molecular-level polymorphism in APOC2 amyloid fibrils via alternative assembly pathways.
17855807 Observational study of gene-disease association. (HuGE Navigator)
17717288 Both common and rare DNA variants of APOC2 gene were found in 10% patients with severe hypertriglyceridemia
17429947 The ozone oxidation product of cholesterol, 3beta-hydroxy-5-oxo-5,6-secocholestan-6-al, rapidly promotes human apolipoprotein (apo) C-II amyloid fibril formation in vitro.
17222387 These results suggested that T-->A substitution at position -190 in the apoC-II gene promoter only partly affected transcriptional activity of the apoC-II promoter, leading to decrease of apoC-II expression in quantity.
17174330 Taken together these data demonstrate an interaction between antichymotrypsin and apolipoprotein C-II that accelerates fibrillogenesis and indicates a specific role for accessory proteins in protein aggregation.
17018885 Decrease of LPL activity in the heart, along with the inhibitory effects of excess apolipoprotein C-II, may contribute to the hypertriglyceridemia observed in apolipoprotein c-ii transgenic mice.
16763159 Observational study of gene-disease association. (HuGE Navigator)
16459141 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16459141 No relationship was found between ApoCII polymorphism and coronary disease in the Chinese Han population.
16432277 Results show that purified human HDL and recombinant apolipoprotein A-I lipid particles bind directly to amyloid beta and apolipoprotein C-II amyloid fibrils.
15778093 Different levels of secreted apoC-II had little effect on LDL and HDL protein degradation by HepG2 cells. Compared to controls, cells under-expressing apoC-II showed a 160% higher capacity to selectively take up HDL-CE.
15031287 This protein, a non-fibrillar component, causes soluble fibrils to condense into localized fibrillar aggregates with a greatly enhanced local density of fibril entanglements.
14746139 Observational study of genotype prevalence. (HuGE Navigator)
12782148 Hydrolysis activated by APOC2 was faster compared with the LPL-mediated lipolysis of emulsion triolein. The binding density of APOC2 was less for small emulsion surfaces than for large ones.
12682050 regions of lipoprotein lipase that are responsive to activation by apoC-II
12590574 Three categories of global constraints, together with the local classical NMR constraints, define the 3D structure of the apoCII-SDS micelle complex and give important clues toward a possible mechanism for the activation of lipoprotein lipase by apoCII.
12450397 During amyloidosis under oxidizing conditions, cysteine-containing apolipoprotein C-II (apoC-II) derivatives form fibrils more rapidly and become extensively tangled compared to wild-type apoC-II.
12220441 Observational study of genotype prevalence. (HuGE Navigator)
12032151 regulated expression of gene cluster in macrophages
11930616 Observational study of gene-disease association. (HuGE Navigator)
11751863 Human apolipoprotein C-II (apoC-II) slowly forms amyloid fibers in lipid-free solutions at physiological pH and salt concentrations
8530039 Includes the observation of APOC4-APOC2 read-through transcription

AA Sequence

MGTRLLPALFLVLLVLGFEVQGTQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEK      1 - 70
LRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE                                            71 - 101
//

Text Mined References (117)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26196342 2015 Hydrogen/Deuterium Exchange and Molecular Dynamics Analysis of Amyloid Fibrils Formed by a D69K Charge-Pair Mutant of Human Apolipoprotein C-II.
26026161 2015 A Pressure-dependent Model for the Regulation of Lipoprotein Lipase by Apolipoprotein C-II.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25172036 2015 Apolipoprotein C-II Tuzla: a novel large deletion in APOC2 caused by Alu-Alu homologous recombination in an infant with apolipoprotein C-II deficiency.
25131724 2014 Quantification and genotyping of lipoprotein lipase in patients with diabetic lipaemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23631828 2013 Identification of potential bladder cancer markers in urine by abundant-protein depletion coupled with quantitative proteomics.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22808166 2012 STAT1 interacts with RXR? to upregulate ApoCII gene expression in macrophages.
22304839 2012 A review of the role of apolipoprotein C-II in lipoprotein metabolism and cardiovascular disease.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22244853 2012 A cyclic peptide inhibitor of apoC-II peptide fibril formation: mechanistic insight from NMR and molecular dynamics analysis.
22239554 2012 Mutations in LPL, APOC2, APOA5, GPIHBP1 and LMF1 in patients with severe hypertriglyceridaemia.
21985034 2011 NBD-labeled phospholipid accelerates apolipoprotein C-II amyloid fibril formation but is not incorporated into mature fibrils.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21476595 2011 Shear flow induced changes in apolipoprotein C-II conformation and amyloid fibril formation.
21321243 2011 Elevated ratio of maternal plasma ApoCIII to ApoCII in preeclampsia.
21146539 2011 A structural model for apolipoprotein C-II amyloid fibrils: experimental characterization and molecular dynamics simulations.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20498921 APOE/C1/C4/C2 gene cluster genotypes, haplotypes and lipid levels in prospective coronary heart disease risk among UK healthy men.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20042600 2010 Site-directed mutagenesis of apolipoprotein CII to probe the role of its secondary structure for activation of lipoprotein lipase.
20031551 2008 Pharmacogenetic predictors of statin-mediated low-density lipoprotein cholesterol reduction and dose response.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19878569 2009 Candidate genetic analysis of plasma high-density lipoprotein-cholesterol and severity of coronary atherosclerosis.
19534808 2009 Lipoprotein lipase activity and mass, apolipoprotein C-II mass and polymorphisms of apolipoproteins E and A5 in subjects with prior acute hypertriglyceridaemic pancreatitis.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19034041 2009 Lipoprotein lipase mutation S447X associated with pancreatic calcification and steatorrhea in hyperlipidemic pancreatitis.
19014618 2008 Apolipoprotein gene polymorphisms and plasma levels in healthy Tunisians and patients with coronary artery disease.
18852267 2008 Fluorescence detection of a lipid-induced tetrameric intermediate in amyloid fibril formation by apolipoprotein C-II.
18802019 2008 Common SNPs in HMGCR in micronesians and whites associated with LDL-cholesterol levels affect alternative splicing of exon13.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18206908 2008 Apolipoprotein C-II amyloid fibrils assemble via a reversible pathway that includes fibril breaking and rejoining.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18005990 2008 Phospholipid interaction induces molecular-level polymorphism in apolipoprotein C-II amyloid fibrils via alternative assembly pathways.
17855807 2007 Maternal and fetal variation in genes of cholesterol metabolism is associated with preterm delivery.
17717288 2007 Resequencing genomic DNA of patients with severe hypertriglyceridemia (MIM 144650).
17429947 2007 Oxidized cholesterol metabolites found in human atherosclerotic lesions promote apolipoprotein C-II amyloid fibril formation.
17336988 2007 Fractionation of cholesteryl ester rich intermediate density lipoprotein subpopulations by chondroitin sulphate.
17222387 2007 Apolipoprotein C-II promoter T-->A substitution at position -190 affects on the transcription of the gene and its relationship to hyperlipemia.
17174330 2007 Serpin acceleration of amyloid fibril formation: a role for accessory proteins.
17018885 2007 Reduction of plasma triglycerides in apolipoprotein C-II transgenic mice overexpressing lipoprotein lipase in muscle.
16968945 2006 Functionally defective high-density lipoprotein: a new therapeutic target at the crossroads of dyslipidemia, inflammation, and atherosclerosis.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16682745 2006 Isolation and characterization of human apolipoprotein M-containing lipoproteins.
16459141 2006 Combined effects of apoE-CI-CII cluster and LDL-R gene polymorphisms on chromosome 19 and coronary artery disease risk.
16432277 2006 High density lipoproteins bind Abeta and apolipoprotein C-II amyloid fibrils.
15878877 2005 Apolipoprotein A-V-heparin interactions: implications for plasma lipoprotein metabolism.
15778093 2005 Apolipoproteins C-II and C-III inhibit selective uptake of low- and high-density lipoprotein cholesteryl esters in HepG2 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15031287 2004 Non-fibrillar components of amyloid deposits mediate the self-association and tangling of amyloid fibrils.
14746139 2003 Molecular variation at functional genes and the history of human populations--data on candidate genes for cardiovascular risk in the Mediterranean.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12783430 2003 Apolipoprotein C-II deficiency presenting as a lipid encephalopathy in infancy.
12782148 2003 Effects of plasma apolipoproteins on lipoprotein lipase-mediated lipolysis of small and large lipid emulsions.
12682050 2003 Identification of a lipoprotein lipase cofactor-binding site by chemical cross-linking and transfer of apolipoprotein C-II-responsive lipolysis from lipoprotein lipase to hepatic lipase.
12590574 2003 Global structure and dynamics of human apolipoprotein CII in complex with micelles: evidence for increased mobility of the helix involved in the activation of lipoprotein lipase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450397 2002 Cross-linking and amyloid formation by N- and C-terminal cysteine derivatives of human apolipoprotein C-II.
12220441 2002 Apolipoprotein molecular variation in Moroccan Berbers: pentanucleotide (TTTTA)n repeat in the LPA gene and APOE-C1-C2 gene cluster.
12032151 2002 Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.
11930616 2001 [Genetic polymorphism analysis of apolipoprotein CII microsatellite DNA (TG) n (AG) m in patients with coronary heart disease].
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
11579204 2001 Farnesoid X-activated receptor induces apolipoprotein C-II transcription: a molecular mechanism linking plasma triglyceride levels to bile acids.
11310852 2001 Expression of the apolipoprotein C-II gene during myelomonocytic differentiation of human leukemic cells.
11162594 2001 Apolipoprotein specificity for lipid efflux by the human ABCAI transporter.
10727238 2000 Apolipoprotein C-II39-62 activates lipoprotein lipase by direct lipid-independent binding.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
8530039 1995 Identification and characterization of a new human gene (APOC4) in the apolipoprotein E, C-I, and C-II gene locus.
8490626 1993 Molecular cloning and characteristics of a new apolipoprotein C-II mutant identified in three unrelated individuals with hypercholesterolemia and hypertriglyceridemia.
8323539 1993 A missense mutation (Trp 26-->Arg) in exon 3 of the apolipoprotein CII gene in a patient with apolipoprotein CII deficiency (apo CII-Wakayama).
8245722 1993 Identification of disulfide-linked apolipoprotein species in human lipoproteins.
8112221 1993 A refined three-dimensional solution structure of a carboxy terminal fragment of apolipoprotein CII.
7923858 1994 The apolipoprotein C-II variant apoC-IILys19-->Thr is not associated with dyslipidemia in an affected kindred.
7815420 1994 Apolipoprotein CII-Padova (Tyr37-->stop) as a cause of chylomicronaemia in an Italian kindred from Siculiana.
6772077 1980 Phospholipid binding studies with synthetic apolipoprotein fragments.
6706938 1984 Amino acid sequence of human plasma apolipoprotein C-II from normal and hyperlipoproteinemic subjects.
6593704 1984 Human apolipoprotein C-II: complete nucleic acid sequence of preapolipoprotein C-II.
6546757 1984 The isolation and characterization of cDNA clones for human apolipoprotein CII.
6328478 1984 Isolation and sequence of a human apolipoprotein CII cDNA clone and its use to isolate and map to human chromosome 19 the gene for apolipoprotein CII.
6328445 1984 Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance.
4345202 1973 Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.
4020294 1985 Inhibitory effects of C apolipoproteins from rats and humans on the uptake of triglyceride-rich lipoproteins and their remnants by the perfused rat liver.
3944271 1986 A variant primary structure of apolipoprotein C-II in individuals of African descent.
3944267 1986 Apolipoprotein C-II deficiency syndrome. Clinical features, lipoprotein characterization, lipase activity, and correction of hypertriglyceridemia after apolipoprotein C-II administration in two affected patients.
3680515 1987 Apolipoprotein CIISt. Michael. Familial apolipoprotein CII deficiency associated with premature vascular disease.
3558370 1987 The human apolipoprotein C-II gene sequence contains a novel chromosome 19-specific minisatellite in its third intron.
3525527 1986 Human preproapolipoprotein C-II. Analysis of major plasma isoforms.
3474626 1987 Human plasma apolipoprotein C-II: total solid-phase synthesis and chemical and biological characterization.
3467353 1987 Structure of apolipoprotein C-IIToronto, a nonfunctional human apolipoprotein.
3263393 1988 Donor splice site mutation in the apolipoprotein (Apo) C-II gene (Apo C-IIHamburg) of a patient with Apo C-II deficiency.
3192518 1988 A deletion mutation in the ApoC-II gene (ApoC-II Nijmegen) of a patient with a deficiency of apolipoprotein C-II.
3030808 1987 The human preproapolipoprotein C-II gene. Complete nucleic acid sequence and genomic organization.
3014272 1986 Isolation of cDNA and genomic clones for apolipoprotein C-II.
2477392 1989 A nonsense mutation in the apolipoprotein C-IIPadova gene in a patient with apolipoprotein C-II deficiency.
2415514 1985 The structure of the human apolipoprotein C-II gene. Electron microscopic analysis of RNA:DNA hybrids, complete nucleotide sequence, and identification of 5' homologous sequences among apolipoprotein genes.
2209608 1990 Primary structure of the bovine analogues to human apolipoproteins CII and CIII. Studies on isoforms and evidence for proteolytic processing.
1971748 1990 Identification of the mutation responsible for a case of plasmatic apolipoprotein CII deficiency (Apo CII-Bari).
1917954 1991 Mechanisms of inhibition by apolipoprotein C of apolipoprotein E-dependent cellular metabolism of human triglyceride-rich lipoproteins through the low density lipoprotein receptor pathway.
1782747 An apolipoprotein CII mutation, CIILys19----Thr' identified in patients with hyperlipidemia.
1555583 1992 Sequence specific 1H-NMR assignments and secondary structure of a carboxy-terminal functional fragment of apolipoprotein CII.
270715 1977 Activation of lipoprotein lipase by native and synthetic fragments of human plasma apolipoprotein C-II.
194244 1977 Primary structure of very low density apolipoprotein C-II of human plasma.
182536 1976 Effect of serum and C-apoproteins from very low density lipoproteins on human postheparin plasma hepatic lipase.