Property Summary

NCBI Gene PubMed Count 174
PubMed Score 256.43
PubTator Score 215.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -1.800 2.2e-02
adrenocortical carcinoma -2.278 1.3e-03
aldosterone-producing adenoma -1.874 5.0e-02
astrocytoma 1.800 1.4e-21
breast carcinoma 2.100 4.6e-05
diabetes mellitus -1.100 1.0e-02
ductal carcinoma in situ 1.800 6.7e-03
esophageal adenocarcinoma 1.500 3.4e-02
glioblastoma 1.100 7.2e-03
head and neck cancer and chronic obstruc... 2.000 1.3e-04
inflammatory breast cancer 1.800 1.1e-02
interstitial cystitis 2.200 2.1e-02
invasive ductal carcinoma 1.782 5.5e-04
lung adenocarcinoma -1.092 1.4e-02
lung cancer -1.300 1.1e-02
lung carcinoma -3.400 6.7e-27
malignant mesothelioma 2.900 4.9e-08
medulloblastoma, large-cell -1.200 2.6e-03
nasopharyngeal carcinoma 1.400 3.8e-03
non-small cell lung cancer -2.119 2.1e-13
oligodendroglioma 1.300 3.6e-09
pediatric high grade glioma 1.100 3.9e-02
psoriasis -1.800 2.4e-04
subependymal giant cell astrocytoma 2.965 3.7e-03

Gene RIF (115)

AA Sequence

MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE      1 - 70
TFQKVKEKLKIDS                                                              71 - 83
//

Text Mined References (178)

PMID Year Title