Property Summary

NCBI Gene PubMed Count 166
PubMed Score 252.92
PubTator Score 215.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 2.900 4.9e-08
esophageal adenocarcinoma 1.500 3.4e-02
psoriasis -2.100 3.7e-34
astrocytoma 1.800 1.4e-21
glioblastoma 3.000 6.7e-03
oligodendroglioma 1.300 3.6e-09
medulloblastoma, large-cell -1.200 2.6e-03
adrenocortical carcinoma -2.278 1.3e-03
non-small cell lung cancer -2.119 2.1e-13
lung cancer -1.900 1.8e-05
breast carcinoma 2.100 4.6e-05
diabetes mellitus -1.100 1.0e-02
interstitial cystitis 2.200 2.1e-02
pediatric high grade glioma 1.100 3.9e-02
aldosterone-producing adenoma -1.874 5.0e-02
subependymal giant cell astrocytoma 2.965 3.7e-03
invasive ductal carcinoma 2.200 1.1e-03
nasopharyngeal carcinoma 1.400 3.8e-03
lung adenocarcinoma -1.092 1.4e-02
inflammatory breast cancer 1.800 1.1e-02
lung carcinoma -3.400 6.7e-27
ductal carcinoma in situ 1.800 6.7e-03
acute myeloid leukemia -1.800 2.2e-02
head and neck cancer and chronic obstruc... 2.000 1.3e-04

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (107)

PMID Text
26639962 This sbioinformatics analysis explored the shared genetic etiology underlying Type 2 Diabetes and Alzheimer's Disease on SNP level, gene level, and pathway level. Six SNPs on APOC1 gene.
26576771 APOC1 SNP is associated with the A beta-42 levels in CSF.
24582705 APOE e4 allele status is associated with dementia and severity of Alzheimer's disease pathologic features in Parkinson disease.
24574346 The ability of apoC1 to inhibit CETP activity is impaired in patients with diabetes. Glycation of apoC1 leads to a change in its electrostatic properties that might account, at least in part, for a loss of constitutive CETP inhibition and an increase in plasma CETP activity in patients with diabetes.
24498013 Data indicate that apolipoprotein C-I (APOC1) rs11568822 polymorphism was associated with increased Alzheimer's disease (AD) risk in Caucasians, Asians and Caribbean Hispanics, but not in African Americans.
24121499 apoC-I and apoC-III inhibit lipolysis by displacing LPL from lipid emulsion particles. We also propose a role for these apolipoproteins in the irreversible inactivation of LPL by factors such as angptl4.
23670531 results suggest that peptide-lipid interactions drive alpha-helix binding to and retention on lipoproteins
23620136 Helical domains that mediate lipid solubilization and ABCA1-specific cholesterol efflux in apolipoproteins C-I and A-II
23555584 Following regression analysis adjusted by collection center, gender, duration of diabetes, and average HbA1c, two SNPs were significantly associated with DN. rs4420638 in the APOC1 region and rs1532624 in CETP.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of apolipoprotein C-I (APOC1) in peptide-treated PBMCs
22995522 Increased white adipose tissue apoC-I secretion in obese women is associated with delayed postprandial dietary fat clearance mediated by increased triglyceride rich apoC-I.
22710912 Linkage disequilibrium between APOC1 and TOMM40 is found in patients with primary progressive aphasia but not in controls or patients with frontotemporal dementia.
22474067 apoC1 as a CETP inhibitor no longer operates on cholesterol redistribution in high-risk patients with dyslipidemia
22404376 The plasma level of apoC-I was significantly increased in obese individuals compared with healthy individuals.
22264166 The observed increase in apoC-I interface affinity due to higher degrees of apoC-I-palmitoyloleoylphosphatidylcholine/triolein/water interactions may explain how apoC-I can displace larger apolipoproteins, such as apoE, from lipoproteins.
22022282 our approach, which is applicable to any set of interval scale traits that is heritable and exhibits evidence of phenotypic clustering, identified three new loci in or near APOC1, BRAP, and PLCG1, which were associated with multiple phenotype domains.
21943158 variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits
21533863 Results describe the association of ACE and APOC1 gene polymorphisms with susceptibility to Alzheimer's disease and dementia in general, both alone and combined with the APOE gene.
21267442 Serum levels of apoC-I and apoC-III combined with other clinical parameters can serve as a basis for the formulation of a diagnostic score for stomach cancer patients
21187063 New isoforms of apoC-I, were detected in the cohort of individuals with coronary artery disease using mass spectrometry while the expected apoC-I isoforms were absent.
20972250 Observational study of gene-disease association. (HuGE Navigator)
20880607 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20864672 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20714348 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20580041 data show that apoCI genotype is associated with serum levels of triglycerides and CRP, confirming the role of apoCI in lipid metabolism and suggesting that it also influences inflammation
20580041 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20498921 This study examines the association between APOE/C1/C4/C2 gene cluster variation using tagging single nucleotide polymorphisms and plasma lipid concentration along with risk of coronary heart disease in a prospective cohort.
20498921 Observational study of gene-disease association. (HuGE Navigator)
20430392 Observational study of gene-disease association. (HuGE Navigator)
20339536 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20308432 Observational study of gene-disease association. (HuGE Navigator)
20145290 ApoE e4 and APOC1 A alleles have a better association with Alzheimer disease than ApoE e4 alone.
20145290 Observational study of gene-disease association. (HuGE Navigator)
19936222 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19812053 From genetic association studies in Canadian Oji-Cree subjects, APOC1 T45S polymorphism may be linked to obesity, adipocyte regulation, body fat, waist circumference, hyperglycemia, and plasma leptin and apolipoprotein C-I levels.
19812053 Observational study of gene-disease association. (HuGE Navigator)
19808960 Single nucleotide polymorphism in apolipoprotein C-I gene was associated with renal cell carcinoma.
19808960 Observational study of gene-disease association. (HuGE Navigator)
19785722 Results identified haptoglobin alpha-1, apolipoprotein C-I and apolipoprotein C-III as candidate biomarkers in PTC.
19761869 Apolipoprotein C-I reduces cholesteryl esters selective uptake from LDL and HDL by binding to HepG2 cells and lipoproteins
19567438 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19494537 Observational study of gene-disease association. (HuGE Navigator)
19417222 Cholesteryl ester transfer protein is the sole major determinant of cholesteryl ester transfer in normolipidemic rabbit plasma as a result of the inability of rabbit apoCI to change HDL electronegativity.
19368908 ApoC-I may have an important role in glucose and lipid metabolism and may be useful for early demonstration of metabolic abnormality in women with polycystic ovary syndrome.
19336575 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19252179 Data show that in African Americans, but not in Caucasians, apoC-I (but not apoE) genotypes were associated with variation in lipoprotein phenotypes, and in particular, the apoC-I H2-allele was associated with an anti-atherogenic pattern.
19252179 Observational study of gene-disease association. (HuGE Navigator)
19062221 APOC1 and its protein isoform are potential bortezomib response markers in multiple myeloma patients.
19014618 Observational study of gene-disease association. (HuGE Navigator)
18984910 Data show that the C-terminal alpha-helix of human apoC-I contains major lipid-binding determinants which play a role in stabilizing the structure of apoC-I, mediating phospholipid interactions, and promoting discoidal particle morphology.
18976728 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18835943 High concentrations of ApoCI are associated with increased triglycerides and decreased visceral fat mass in men with metabolic syndrome X.
18667498 ApoC1 associates intracellularly via its C-terminal region with surface components of virions during viral morphogenesis and may play a major role in the replication cycle of HCV
18160739 human apoC-I expression impairs cognitive functions in mice independent of apoE expression, which supports the potential of a modulatory role for apoC-I during the development of Alzheimer's disease
18049452 findings in human APOC1(+/+) transgenic mice underscore the role of skin barrier integrity in the pathogenesis of atopic dermatitis
18037960 Specific expression of ApoC-1 and its role in preventing spontaneous apoptosis in pancreatic cancer cells suggest that ApoC-1 contributes to the aggressiveness of pancreatic cancer.
17998437 Genome-wide association study of gene-disease association. (HuGE Navigator)
17936795 The expression of apo C1 and apo E are closely associated with the susceptibility to the pathogenesis of atherosclerosis
17761674 Study demonstrates that apoC-I, an exchangeable apolipoprotein that predominantly resides in HDL, specifically enhances HCV infectivity and increases the fusion rates between viral and target membranes via a direct interaction with the HCV surface.
17667986 ApoC-I losses during hemodialysis might be beneficial by improving the ability of very low-density lipoprotein to be a substrate for lipoprotein lipase thus improving plasma triglyceride metabolism.
17341095 positive cooperativity in binding of alpha-helices to phospholipid surface, which may result from direct and/or lipid-mediated protein-protein interactions, may be important for lipoprotein metabolism and for protein-membrane binding.
17310220 Five gender-matched sibling pairs, persons with Mexican ancestry, showed a 1.34-fold higher body mass index for those with S45 ApoC1 (P=0.022). ApoC1 may contribute to the elevated rates of diabetes in relevant ethnic groups.
17254710 Observational study of gene-disease association. (HuGE Navigator)
16935938 Through avid binding to LPS, apoCI improved the presentation of LPS to macrophages in vitro and in mice, thereby stimulating the inflammatory response to LPS, reducing the number of circulating bacteria, and protecting mice against fatal sepsis.
16763159 Observational study of gene-disease association. (HuGE Navigator)
16631424 Observational study of gene-disease association. (HuGE Navigator)
16631424 APOC1 HpaI polymorphism is associated with gallstone disease and shows gender-specific differences.
16608402 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16544732 Observational study of gene-disease association. (HuGE Navigator)
16478678 irrespective of receptor-mediated remnant clearance by the liver, liver-specific expression of recombinant human apoCI causes hypertriglyceridemia in the absence of the VLDLr and apoCIII in mice
16459141 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16459141 ApoCI polymorphism is related to coronary disease in the Chinese Han population, with smoking and alcohol drinking increasing the genetic predisposition to disease.
16159884 The molecular mechanism of the apoCI-mediated blockade of CETP activity is reported.
15900219 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15840864 Increased amounts of apolipoprotein C-I enriched HDL may have physiological significance and identify a novel group of low-birth-weight infants apparently distinct from traditionally classified small-for-gestational-age infants.
15793777 Results suggested that both apoE and apoCI on chromosome 19 were the susceptibility loci for coronary artery disease, their linkage disequilibrium should be responsible for the development of coronary artery disease .
15777558 Observational study of gene-disease association. (HuGE Navigator)
15769335 Observational study of gene-disease association. (HuGE Navigator)
15767578 role of apolipoprotein C1 in the infection process of hepatitis C virus
15576844 apoC-I is a potent inhibitor of LPL-mediated triglyceride lipolysis
15364690 Observational study of gene-disease association. (HuGE Navigator)
15339254 overexpression of apoCI does not represent a suitable method for decreasing total CE transfer activity in CETP/apoCI transgenic mice, owing to an hyperlipidaemia-mediated effect on CETP gene expression
15077570 Observational study of gene-disease association. (HuGE Navigator)
14746139 Observational study of genotype prevalence. (HuGE Navigator)
14705977 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14523051 overexpression of APOC1 prevents rosiglitazone-induced peripheral fatty acid uptake leading to severe hepatic steatosis
12962909 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12860251 Observational study of gene-disease association. (HuGE Navigator)
12805445 The endogenous retroviral promoters (LTRs) of the human endothelin B receptor (EDNRB) and apolipoprotein C1 (APOC1) genes have high sequence identity but differ in activity and tissue specificity.
12736801 Observational study of gene-disease association. (HuGE Navigator)
12736801 The effect of APOC1 genes on brain MRI measures were studied in subjects with age-associated memory impairment. The effects of APOC1 on hippocampal volumes appeared to be more robust than those of the APOE polymorphism.
12705839 Effects of mutations in apolipoprotein C-1 on the reconstitution and kinetic stability of discoidal lipoproteins.
12678662 Observational study of gene-disease association. (HuGE Navigator)
12429068 Observational study of genetic testing. (HuGE Navigator)
12220441 Observational study of genotype prevalence. (HuGE Navigator)
12113906 Observational study of gene-disease association. (HuGE Navigator)
12044170 Thermal unfolding of discoidal complexes of apolipoprotein (apo) C-1 with dimyristoyl phosphatidylcholine (DMPC) reveals a novel mechanism of lipoprotein stabilization that is based on kinetics rather than thermodynamics.
12032151 regulated expression of gene cluster in macrophages
11825674 Observational study of gene-disease association. (HuGE Navigator)
11825674 APOC1 might be an additional susceptibility gene for late onset Alzheimer disease.
11702052 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE      1 - 70
TFQKVKEKLKIDS                                                              71 - 83
//

Text Mined References (170)

PMID Year Title
26639962 2016 Shared Genetic Etiology between Type 2 Diabetes and Alzheimer's Disease Identified by Bioinformatics Analysis.
26576771 2016 Combined Genome-Wide CSF A?-42's Associations and Simple Network Properties Highlight New Risk Factors for Alzheimer's Disease.
25785516 2015 Human endogenous retrovirus group E and its involvement in diseases.
25350695 2014 Pharmacogenetic meta-analysis of genome-wide association studies of LDL cholesterol response to statins.
25160599 2014 Higher primates, but not New World monkeys, have a duplicate set of enhancers flanking their apoC-I genes.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24688116 2014 Genome-wide association meta-analysis of human longevity identifies a novel locus conferring survival beyond 90 years of age.
24582705 2014 Clinical and pathologic presentation in Parkinson's disease by apolipoprotein e4 allele status.
24574346 2014 Glycation of apolipoprotein C1 impairs its CETP inhibitory property: pathophysiological relevance in patients with type 1 and type 2 diabetes.
24498013 2014 Association between APOC1 polymorphism and Alzheimer's disease: a case-control study and meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121499 2013 Apolipoproteins C-I and C-III inhibit lipoprotein lipase activity by displacement of the enzyme from lipid droplets.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
23726366 2013 Genome-wide characterization of shared and distinct genetic components that influence blood lipid levels in ethnically diverse human populations.
23670531 2013 Changes in helical content or net charge of apolipoprotein C-I alter its affinity for lipid/water interfaces.
23620136 2013 Helical domains that mediate lipid solubilization and ABCA1-specific cholesterol efflux in apolipoproteins C-I and A-II.
23555584 2013 Association analysis of dyslipidemia-related genes in diabetic nephropathy.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23419831 2014 APOE and BCHE as modulators of cerebral amyloid deposition: a florbetapir PET genome-wide association study.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
23031429 2012 A genome-wide association study of monozygotic twin-pairs suggests a locus related to variability of serum high-density lipoprotein cholesterol.
22995522 2012 White adipose tissue apolipoprotein C-I secretion in relation to delayed plasma clearance of dietary fat in humans.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22832961 2012 Genome-wide association study of Alzheimer's disease.
22710912 2012 TOMM40, APOE, and APOC1 in primary progressive aphasia and frontotemporal dementia.
22474067 2012 Constitutive inhibition of plasma CETP by apolipoprotein C1 is blunted in dyslipidemic patients with coronary artery disease.
22404376 2012 Secretome-derived isotope tags (SDIT) reveal adipocyte-derived apolipoprotein C-I as a predictive marker for cardiovascular disease.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
22264166 2012 Apolipoprotein C-I binds more strongly to phospholipid/triolein/water than triolein/water interfaces: a possible model for inhibiting cholesterol ester transfer protein activity and triacylglycerol-rich lipoprotein uptake.
22054870 2012 A genome-wide scan for common variants affecting the rate of age-related cognitive decline.
22022282 2011 A phenomics-based strategy identifies loci on APOC1, BRAP, and PLCG1 associated with metabolic syndrome phenotype domains.
22005931 2012 Genome-wide association analysis of age-at-onset in Alzheimer's disease.
22003152 2012 Eight genetic loci associated with variation in lipoprotein-associated phospholipase A2 mass and activity and coronary heart disease: meta-analysis of genome-wide association studies from five community-based studies.
21943158 2011 Genetic variants in LPL, OASL and TOMM40/APOE-C1-C2-C4 genes are associated with multiple cardiovascular-related traits.
21909108 2011 Meta-analysis of genome-wide association studies from the CHARGE consortium identifies common variants associated with carotid intima media thickness and plaque.
21740922 A genome-wide association study confirms APOE as the major gene influencing survival in long-lived individuals.
21533863 2011 Genetic influences on Alzheimer's disease: evidence of interactions between the genes APOE, APOC1 and ACE in a sample population from the South of Brazil.
21300955 2011 Meta-analysis of genome-wide association studies in >80 000 subjects identifies multiple loci for C-reactive protein levels.
21267442 2011 Serum apolipoproteins C-I and C-III are reduced in stomach cancer patients: results from MALDI-based peptidome and immuno-based clinical assays.
21196492 2011 Genome-wide association study for C-reactive protein levels identified pleiotropic associations in the IL6 locus.
21187063 2011 Isoforms of apolipoprotein C-I associated with individuals with coronary artery disease.
20972250 2011 Genetic loci associated with lipid concentrations and cardiovascular risk factors in the Korean population.
20880607 2012 Exploration of 16 candidate genes identifies the association of IDE with Alzheimer's disease in Han Chinese.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20838585 2010 Longitudinal genome-wide association of cardiovascular disease risk factors in the Bogalusa heart study.
20714348 2010 Common inherited variation in mitochondrial genes is not enriched for associations with type 2 diabetes or related glycemic traits.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20580041 2010 Apolipoprotein C-I genotype and serum levels of triglycerides, C-reactive protein and coronary heart disease.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20498921 APOE/C1/C4/C2 gene cluster genotypes, haplotypes and lipid levels in prospective coronary heart disease risk among UK healthy men.
20442857 2010 Genome-wide association study of Lp-PLA(2) activity and mass in the Framingham Heart Study.
20430392 2010 No interaction between alcohol consumption and HDL-related genes on HDL cholesterol levels.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20308432 2010 Association analysis of 33 lipoprotein candidate genes in multi-generational families of African ancestry.
20209111 2010 Detection of two distinct forms of apoC-I in great apes.
20145290 2010 Association of apolipoproteins e4 and c1 with onset age and memory: a study of sporadic Alzheimer disease in Taiwan.
19936222 2009 Forty-three loci associated with plasma lipoprotein size, concentration, and cholesterol content in genome-wide analysis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19812053 2010 APOC1 T45S polymorphism is associated with reduced obesity indices and lower plasma concentrations of leptin and apolipoprotein C-I in aboriginal Canadians.
19808960 2009 Apolipoprotein E/C1 locus variants modify renal cell carcinoma risk.
19785722 2009 Discovery and identification of potential biomarkers of papillary thyroid carcinoma.
19761869 2010 Apolipoprotein C-I reduces cholesteryl esters selective uptake from LDL and HDL by binding to HepG2 cells and lipoproteins.
19567438 2009 Genetic Loci associated with C-reactive protein levels and risk of coronary heart disease.
19494537 2009 Apolipoprotein E, CI and B gene polymorphisms in a sample of patients with coronary heart disease in the Kuwaiti population.
19417222 2009 Apolipoprotein CI is a physiological regulator of cholesteryl ester transfer protein activity in human plasma but not in rabbit plasma.
19368908 2010 Can serum apolipoprotein C-I demonstrate metabolic abnormality early in women with polycystic ovary syndrome?
19336575 2009 Genetic analysis of coronary artery disease single-nucleotide polymorphisms in diabetic nephropathy.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19252179 2009 ApoE and ApoC-I polymorphisms: association of genotype with cardiovascular disease phenotype in African Americans.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
19062221 2009 Elucidation of potential bortezomib response markers in mutliple myeloma patients.
19060906 2009 Common variants at 30 loci contribute to polygenic dyslipidemia.
19014618 2008 Apolipoprotein gene polymorphisms and plasma levels in healthy Tunisians and patients with coronary artery disease.
18992221 2008 Apolipoprotein CI inhibits scavenger receptor BI and increases plasma HDL levels in vivo.
18984910 2009 Aromatic residues in the C-terminal helix of human apoC-I mediate phospholipid interactions and particle morphology.
18976728 2008 Genome-wide association analysis reveals putative Alzheimer's disease susceptibility loci in addition to APOE.
18835943 2009 Plasma apolipoprotein CI and CIII levels are associated with increased plasma triglyceride levels and decreased fat mass in men with the metabolic syndrome.
18802019 2008 Common SNPs in HMGCR in micronesians and whites associated with LDL-cholesterol levels affect alternative splicing of exon13.
18667498 2008 Apolipoprotein c1 association with hepatitis C virus.
18262040 2008 LDL-cholesterol concentrations: a genome-wide association study.
18193044 2008 Six new loci associated with blood low-density lipoprotein cholesterol, high-density lipoprotein cholesterol or triglycerides in humans.
18193043 2008 Newly identified loci that influence lipid concentrations and risk of coronary artery disease.
18160739 2008 Human apolipoprotein C-I expression in mice impairs learning and memory functions.
18049452 2008 Development of atopic dermatitis in mice transgenic for human apolipoprotein C1.
18037960 2008 Apolipoprotein C-1 maintains cell survival by preventing from apoptosis in pancreatic cancer cells.
17998437 2008 Candidate single-nucleotide polymorphisms from a genomewide association study of Alzheimer disease.
17975299 2008 Sorl1 as an Alzheimer's disease predisposition gene?
17936795 2008 Apolipoprotein C1 and apolipoprotein E are differentially expressed in atheroma of the carotid and femoral artery.
17761674 2007 The exchangeable apolipoprotein ApoC-I promotes membrane fusion of hepatitis C virus.
17667986 2007 Hemodialysis reduces plasma apolipoprotein C-I concentration making VLDL a better substrate for lipoprotein lipase.
17474819 2007 A high-density whole-genome association study reveals that APOE is the major susceptibility gene for sporadic late-onset Alzheimer's disease.
17463246 2007 Genome-wide association analysis identifies loci for type 2 diabetes and triglyceride levels.
17341095 2007 Role of secondary structure in protein-phospholipid surface interactions: reconstitution and denaturation of apolipoprotein C-I:DMPC complexes.
17339654 2007 Apolipoprotein C-I binds free fatty acids and reduces their intracellular esterification.
17310220 2007 Correlation of a T45S variant of apolipoprotein C1 with elevated BMI in persons of American Indian and Mexican ancestries.
17254710 2007 APOE genotypes in African American female multiple sclerosis patients.
17053273 2007 Hepatic lipid accumulation in apolipoprotein C-I-deficient mice is potentiated by cholesteryl ester transfer protein.
16981907 2006 A functional polymorphism of apolipoprotein C1 detected by mass spectrometry.
16935938 2006 Apolipoprotein CI stimulates the response to lipopolysaccharide and reduces mortality in gram-negative sepsis.
16763159 2006 Consistent effects of genes involved in reverse cholesterol transport on plasma lipid and apolipoprotein levels in CARDIA participants.
16631424 2006 Association of APOE-C1 gene cluster polymorphisms with gallstone disease.
16608402 2006 Membership in genetic groups predicts Alzheimer disease.
16544732 2006 Candidate gene polymorphism in cardiovascular disease: the BIP cohort.
16478678 2006 Apolipoprotein CI causes hypertriglyceridemia independent of the very-low-density lipoprotein receptor and apolipoprotein CIII in mice.
16459141 2006 Combined effects of apoE-CI-CII cluster and LDL-R gene polymorphisms on chromosome 19 and coronary artery disease risk.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16159884 2005 Molecular mechanism of the blockade of plasma cholesteryl ester transfer protein by its physiological inhibitor apolipoprotein CI.
15900219 2005 Paraoxonase-1 promoter polymorphism C--107T and serum apolipoprotein AI interact to modulate serum paraoxonase-1 status.
15840864 2005 A large high-density lipoprotein enriched in apolipoprotein C-I: a novel biochemical marker in infants of lower birth weight and younger gestational age.
15793777 2005 [The apolipoprotein E-CI-CII gene cluster polymorphisms and coronary artery disease].
15777558 2005 The common insertional polymorphism in the APOC1 promoter is associated with serum apolipoprotein C-I levels in Hispanic children.
15769335 2004 [Genetic association of apoE and apoCI gene polymorphisms with coronary heart disease].
15767578 2005 Evidence for cross-genotype neutralization of hepatitis C virus pseudo-particles and enhancement of infectivity by apolipoprotein C1.
15576844 2005 Severe hypertriglyceridemia in human APOC1 transgenic mice is caused by apoC-I-induced inhibition of LPL.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364690 2004 APOE and APOC1 promoter polymorphisms and the risk of Alzheimer disease in African American and Caribbean Hispanic individuals.
15339254 2005 Apolipoprotein CI overexpression is not a relevant strategy to block cholesteryl ester transfer protein (CETP) activity in CETP transgenic mice.
15077570 2004 [Antagonistic effect of the insertion/deletion (HpaI) polymorphism in the regulatory part of the gene for apolipoprotein CI in children with high and low levels of cholesterol].
14746139 2003 Molecular variation at functional genes and the history of human populations--data on candidate genes for cardiovascular risk in the Mediterranean.
14705977 2004 Association between apolipoprotein CI HpaI polymorphism and sporadic Alzheimer's disease in Chinese.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14523051 2004 Overexpression of APOC1 in obob mice leads to hepatic steatosis and severe hepatic insulin resistance.
12962909 2003 Apolipoprotein E -491 promoter polymorphism is an independent risk factor for Alzheimer's disease in the Chinese population.
12860251 2003 Plasma concentration and lipoprotein distribution of ApoC-I is dependent on ApoE genotype rather than the Hpa I ApoC-I promoter polymorphism.
12805445 2003 Functional analysis of the endogenous retroviral promoter of the human endothelin B receptor gene.
12736801 2003 Apolipoproteins E and C1 and brain morphology in memory impaired elders.
12705839 2003 Effects of mutations in apolipoprotein C-1 on the reconstitution and kinetic stability of discoidal lipoproteins.
12678662 2003 Apolipoprotein E and apolipoprotein CI polymorphisms in the Czech population: almost complete linkage disequilibrium of the less frequent alleles of both polymorphisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429068 2002 An improved RSP method to detect HpaI polymorphism in the apolipoprotein C-1 gene promoter.
12220441 2002 Apolipoprotein molecular variation in Moroccan Berbers: pentanucleotide (TTTTA)n repeat in the LPA gene and APOE-C1-C2 gene cluster.
12113906 2002 Relationship among (1)H-magnetic resonance spectroscopy, brain volumetry and genetic polymorphisms in humans with memory impairment.
12032151 2002 Regulated expression of the apolipoprotein E/C-I/C-IV/C-II gene cluster in murine and human macrophages. A critical role for nuclear liver X receptors alpha and beta.
11825674 2002 Genetic association of an apolipoprotein C-I (APOC1) gene polymorphism with late-onset Alzheimer's disease.
11702052 2001 Potential genetic markers of sporadic Alzheimer's dementia.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11162594 2001 Apolipoprotein specificity for lipid efflux by the human ABCAI transporter.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11054415 2001 Long terminal repeats are used as alternative promoters for the endothelin B receptor and apolipoprotein C-I genes in humans.
10978346 2000 Human apolipoprotein C-I accounts for the ability of plasma high density lipoproteins to inhibit the cholesteryl ester transfer protein activity.
10545169 1999 Conformation of human apolipoprotein C-I in a lipid-mimetic environment determined by CD and NMR spectroscopy.
10520737 1998 Sequencing of 42kb of the APO E-C2 gene cluster reveals a new gene: PEREC1.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
9300485 1997 Conformational studies of the N-terminal lipid-associating domain of human apolipoprotein C-I by CD and 1H NMR spectroscopy.
8804993 1996 Genetic association study between senile dementia of Alzheimer's type and APOE/C1/C2 gene cluster.
8432525 1993 Fluorescence in situ hybridization mapping of human chromosome 19: cytogenetic band location of 540 cosmids and 70 genes or DNA markers.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7779782 1995 Conformation of two peptides corresponding to human apolipoprotein C-I residues 7-24 and 35-53 in the presence of sodium dodecyl sulfate by CD and NMR spectroscopy.
7471419 1981 Quantitative determination of apolipoproteins C-I and C-II in human plasma by separate electroimmunoassays.
6789904 1981 Evaluation of the mixed interaction between apolipoproteins A-II and C-I equilibrium sedimentation.
6328444 1984 Characterisation of mRNAs encoding the precursor for human apolipoprotein CI.
4369340 1974 The primary structure of apolopoprotein-serine.
4020294 1985 Inhibitory effects of C apolipoproteins from rats and humans on the uptake of triglyceride-rich lipoproteins and their remnants by the perfused rat liver.
3017837 1986 The gene for human apolipoprotein CI is located 4.3 kilobases away from the apolipoprotein E gene on chromosome 19.
3013172 1986 There are two gene sequences for human apolipoprotein CI (apo CI) on chromosome 19, one of which is 4 kb from the gene for apo E.
2985493 1985 Isolation and characterisation of a cDNA clone for human apolipoprotein CI and assignment of the gene to chromosome 19.
2897845 1988 Exact localization of the familial dysbetalipoproteinemia associated HpaI restriction site in the promoter region of the APOC1 gene.
2835369 1988 Two copies of the human apolipoprotein C-I gene are linked closely to the apolipoprotein E gene.
2302419 1990 Apolipoprotein C-1 inhibits the hydrolysis by phospholipase A2 of phospholipids in liposomes and cell membranes.
1917954 1991 Mechanisms of inhibition by apolipoprotein C of apolipoprotein E-dependent cellular metabolism of human triglyceride-rich lipoproteins through the low density lipoprotein receptor pathway.
182536 1976 Effect of serum and C-apoproteins from very low density lipoproteins on human postheparin plasma hepatic lipase.
166984 1975 Thf complete amino acid sequence of C-I (apoLp-Ser), an apolipoprotein from human very low density lipoproteins.