Property Summary

NCBI Gene PubMed Count 361
PubMed Score 662.16
PubTator Score 538.69

Knowledge Summary


No data available


  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.480 7.0e-03
adrenocortical carcinoma -1.280 2.5e-02
adult high grade glioma 1.200 5.9e-03
astrocytoma -1.200 2.5e-02
Astrocytoma, Pilocytic 1.300 1.0e-04
Breast cancer 1.800 4.5e-02
chronic kidney disease 1.200 3.8e-02
Chronic Lymphocytic Leukemia 1.218 1.1e-02
cutaneous lupus erythematosus 2.700 9.3e-05
glioblastoma 1.200 5.4e-04
invasive ductal carcinoma 1.023 9.5e-03
lung cancer -2.100 2.1e-03
lung carcinoma -1.700 1.0e-18
malignant mesothelioma 3.900 1.4e-09
osteosarcoma -2.397 1.6e-03
ovarian cancer -1.100 9.6e-05
pituitary cancer 2.000 3.7e-05
primary Sjogren syndrome 2.400 1.4e-04
psoriasis 1.100 2.4e-05
subependymal giant cell astrocytoma 2.007 4.5e-02
tuberculosis and treatment for 6 months -1.300 5.4e-05
ulcerative colitis 2.600 2.6e-05

PDB (10)

Gene RIF (647)

AA Sequence

VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN                                        351 - 384

Text Mined References (374)

PMID Year Title