Property Summary

NCBI Gene PubMed Count 22
PubMed Score 26.39
PubTator Score 70.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
25461536 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25408426 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25352838 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25330146 APOBEC3D/F and APOBEC3G fundamentally work as restriction factors against HIV-1 in vivo
25330146 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
25206352 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
24657093 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
24227842 APOBEC3 deaminases upregulated by IFN-beta induce E2 hypermutation of HPV16 in cervical keratinocytes.
24189052 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
23755966 We found that two common novel polymorphisms in APOBEC3D decrease antiviral activity against HIV-1, and one polymorphism decreases activity against Alu retrotransposons in the human population.
23097438 The authors conclude that APOBEC3G exerts a greater restriction effect on HIV-1 than APOBEC3F and APOBEC3DE.
23097438 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
23043103 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
23043100 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
23001005 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
22915799 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
22912627 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
22807680 endogenous levels of APOBEC3D, APOBEC3F, and APOBEC3G combine to restrict Vif-deficient HIV-1 and cause the hallmark dinucleotide hypermutation patterns in in the nonpermissive T cell line CEM2n
22807680 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
22720156 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
22205746 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
22203821 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
21835787 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
20943965 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
20174454 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
20096141 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
20012521 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
19649317 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
19535450 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
19344514 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
19088851 Distinct determinants in HIV-1 Vif and human APOBEC3 proteins are required for the suppression of diverse host anti-viral proteins.
19088851 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
19038776 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
19008196 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
18577210 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
18304004 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface
16920826 Immunoblotting and crystal structure analyses reveal ten amino acids L268, F271, C272, I275, L276, S277, Y282, D302, F303, and H307 in APOBEC3D are involved in forming Vif-interaction interface

AA Sequence

MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQE      1 - 70
VYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRD     71 - 140
RDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNPMEAMYP    141 - 210
HIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNT    211 - 280
NYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFV    281 - 350
SCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ                                      351 - 386
//

Text Mined References (27)

PMID Year Title
25330146 2014 APOBEC3D and APOBEC3F potently promote HIV-1 diversification and evolution in humanized mouse model.
24227842 2014 APOBEC3 deaminases induce hypermutation in human papillomavirus 16 DNA upon beta interferon stimulation.
23755966 2013 Identification and antiviral activity of common polymorphisms in the APOBEC3 locus in human populations.
23152537 2013 Suppression of HIV-1 infection by APOBEC3 proteins in primary human CD4(+) T cells is associated with inhibition of processive reverse transcription as well as excessive cytidine deamination.
23097438 2013 APOBEC3G restricts HIV-1 to a greater extent than APOBEC3F and APOBEC3DE in human primary CD4+ T cells and macrophages.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22912627 2012 Retroelements versus APOBEC3 family members: No great escape from the magnificent seven.
22807680 2012 Endogenous origins of HIV-1 G-to-A hypermutation and restriction in the nonpermissive T cell line CEM2n.
22001110 2012 Functions and regulation of the APOBEC family of proteins.
21835787 2011 Human and rhesus APOBEC3D, APOBEC3F, APOBEC3G, and APOBEC3H demonstrate a conserved capacity to restrict Vif-deficient HIV-1.
20308164 2010 Quantitative profiling of the full APOBEC3 mRNA repertoire in lymphocytes and tissues: implications for HIV-1 restriction.
20062055 2010 APOBEC3 proteins mediate the clearance of foreign DNA from human cells.
19088851 2008 Distinct determinants in HIV-1 Vif and human APOBEC3 proteins are required for the suppression of diverse host anti-viral proteins.
18304004 2008 The APOBEC3 cytidine deaminases: an innate defensive network opposing exogenous retroviruses and endogenous retroelements.
16920826 2006 Identification of APOBEC3DE as another antiretroviral factor from the human APOBEC family.
16648136 2006 APOBEC3B and APOBEC3F inhibit L1 retrotransposition by a DNA deamination-independent mechanism.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15516966 2004 Retroviral restriction by APOBEC proteins.
15496550 2005 Evolution of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15269786 2004 Ancient adaptive evolution of the primate antiviral DNA-editing enzyme APOBEC3G.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12683974 2003 Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11863358 2002 An anthropoid-specific locus of orphan C to U RNA-editing enzymes on chromosome 22.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10591208 1999 The DNA sequence of human chromosome 22.