Property Summary

NCBI Gene PubMed Count 57
PubMed Score 43.70
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
subependymal giant cell astrocytoma 1.121 1.7e-02
lung carcinoma -1.500 1.3e-26
acute myeloid leukemia 1.400 3.0e-02

Gene RIF (69)

PMID Text
26682542 These results suggest that functional potential of APOBEC3B and APOBEC3C involved in cancer mutagenesis is associated with estrogen receptor status.
25724652 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25650088 High APOBEC3C is associated with the pathogenesis of primary effusion lymphoma.
25576866 Expression of APOBEC3A or 3C in 293FT cells reduced the infectivity of HPV16 pseudovirions. The reduced infectivity of virions assembled in the presence of APOBEC3A, but not 3C, was attributed to decreased copy number of the encapsidated reporter plasmid.
25461536 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25408426 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25352838 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25170834 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25124760 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
24657093 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
24248339 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
24227842 APOBEC3 deaminases upregulated by IFN-beta induce E2 hypermutation of HPV16 in cervical keratinocytes.
24189052 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
24101588 The mechanism of APOBEC3C (A3C)-mediated LINE-1 inhibition was found to be deaminase independent, required an intact dimerization site and the RNA-binding pocket mutation R122A abolished L1 restriction by A3C.
23787464 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
23715497 This study confirmed the association of the APOBEC3 deletion with breast cancer risk among women of European ancestry.
23043103 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
23001005 a high-resolution crystal structure of APOBEC3C with the HIV-1 viral infectivity factor (Vif)-interaction interface.
23001005 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
22948384 Decreases in APOBAC3A and APOBAC3C in the cortex of psychotic patients support the hypothesis that an epigenetic misregulation of gene expression may be operative in the pathogenesis of psychotic disorders.
22915799 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
22912627 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
22379088 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
22205746 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
22145963 Findings suggest that APOBEC3-mediated editing of HIV-1 could be modulated by host and virus genetic characteristics in the context of pediatric infection.
21746770 The result suggest that Core-A3C may be a candidate as a novel antiviral agent against human HBV infection.
21430060 The authors identified a single cysteine at position 320 (C320) that disrupts A3DE activity.
21368204 Somatic hypermutation of human mitochondrial and nuclear DNA by APOBEC3 cytidine deaminases, a pathway for DNA catabolism.
21279453 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
20943965 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
20926562 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
20174454 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
20096141 The basic biology of the interactions between human APOBEC3 proteins and HIV-1 Vif, is reviewed.
20012521 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
19911124 Studies indicate the APOBEC family consists of 11 members: APOBEC-1 (Apo1), APOBEC-2 (Apo2), activation induced cytidine deaminase (AID), APOBEC- 3A, -3B, -3C, -3DE, -3F, -3H (Apo3A-H) and APOBEC- 4 (Apo4).
19581596 The structure of APOBEC3C (A3C), a single-domain A3 with strong antilentiviral activity, was modeled.
19581596 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
19535450 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
19390611 APOBEC3 roles in limiting viruse pathogenicity by partially restricting infection
19369234 Major cellular components of human BRB could be primary cultured in vitro and different expression of APOBEC3 in human blood-retinal barrier was examined.
19109396 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
19088851 Distinct determinants in HIV-1 Vif and human APOBEC3 proteins are required for the suppression of diverse host anti-viral proteins.
19088851 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18846074 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18806783 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18702815 IAPE and HERV-K elements are restricted at the entry, amplification and integration into their target genomes by the host APOBEC3 proteins.
18577210 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18555089 Human APOBEC3 proteins inhibit porcine endogenous retrovirus replication, which may reduce risk for infection of human cells as a consequence of pig-to-human xenotransplantation.
18495196 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18420796 These results indicate that APOBEC3G, APOBEC3C and APOBEC3H have the ability to edit HBV DNA and that each protein is likely to contribute to various degrees to the generation of modified genomes in human liver cells.
18419775 Cul5-E3 ubiquitin ligase appears to be a common pathway hijacked by HIV-1 and SIV Vif to defeat APOBEC3 proteins.
18419775 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18391217 Partially active Vif alleles resulting in incomplete neutralization of cytoplasmic APOBEC3 molecules are directly responsible for the generation of a highly diverse, yet G-to-A biased, proviral reservoir
18304004 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
18032489 Study compared the antiviral activities of human and murine Apobec3 (A3), and found that, HIV is able to resist human A3G but is sensitive to murine A3, whereas murine leukemia virus is relatively resistant to murine A3 but sensitive to human A3G.
17977970 Stress causes APOBEC3A, APOBEC3B, APOBEC3C, and APOBEC3F to colocalize efficiently with Vif(IIIB) and mRNA-PABP1 complexes in stress granules
17977970 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
17967058 study demonstrate that APOBEC3C is necessary and sufficient for G-to-A mutations in some HIV-1 strains
17967058 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
17672864 APOBEC3 suppresses HBV replication in hepatocytes by inhibiting hnRNP K-mediated transcription and expression of HBV genes as well as HBV core DNA synthesis.
17625792 These findings demonstrate that HBV is highly vulnerable to the editing activity of an endogenous human deaminase and suggest that A3C could contribute to innate anti-HBV host responses.
17582006 The catalytic domain of APOBEC3 proteins may be important for proper folding and target factors such as RNA or protein interaction in addition to cytidine deamination.
17371941 Differences in promiscuity of monocytes, macrophages, and DCs can be defined, at least partly, by disparities in APOBEC expression, with implications for enhancing cellular defenses against HIV-1.
17078485 reviews the current knowledge on the mechanism of APOBEC3-dependent retrovirus restriction and discuss whether this innate host-defense system actively contributes to HIV genetic variation
16735504 evidence for a role of host-encoded APOBEC3 proteins in the regulation of L1 retrotransposition
16414984 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
15956565 APOBEC3 proteins may help prevent the zoonotic infection of humans by simple retroviruses and provide a mechanism for how simple retroviruses can avoid inhibition by APOBEC3 family members.
15809227 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
15466872 different APOBEC3 family members function to neutralize specific lentiviruses

AA Sequence

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC      1 - 70
FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ     71 - 140
EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ                        141 - 190
//

Text Mined References (64)

PMID Year Title
27643540 2016 Association of germline variants in the APOBEC3 region with cancer risk and enrichment with APOBEC-signature mutations in tumors.
26682542 2015 Integrative genomic analysis reveals functional diversification of APOBEC gene family in breast cancer.
25650088 2015 Analysis of mutational signatures in exomes from B-cell lymphoma cell lines suggest APOBEC3 family members to be involved in the pathogenesis of primary effusion lymphoma.
25576866 2015 APOBEC3A and 3C decrease human papillomavirus 16 pseudovirion infectivity.
25416956 2014 A proteome-scale map of the human interactome network.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24227842 2014 APOBEC3 deaminases induce hypermutation in human papillomavirus 16 DNA upon beta interferon stimulation.
24101588 2014 Human LINE-1 restriction by APOBEC3C is deaminase independent and mediated by an ORF1p interaction that affects LINE reverse transcriptase activity.
23715497 2013 APOBEC3 deletion polymorphism is associated with breast cancer risk among women of European ancestry.
23001005 2012 The APOBEC3C crystal structure and the interface for HIV-1 Vif binding.
22977230 2012 Human Tribbles 3 protects nuclear DNA from cytidine deamination by APOBEC3A.
22948384 2012 Upregulation of TET1 and downregulation of APOBEC3A and APOBEC3C in the parietal cortex of psychotic patients.
22915799 2012 HIV-1 replication and APOBEC3 antiviral activity are not regulated by P bodies.
22912627 2012 Retroelements versus APOBEC3 family members: No great escape from the magnificent seven.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22145963 2012 APOBEC3-mediated editing in HIV type 1 from pediatric patients and its association with APOBEC3G/CUL5 polymorphisms and Vif variability.
22001110 2012 Functions and regulation of the APOBEC family of proteins.
21835787 2011 Human and rhesus APOBEC3D, APOBEC3F, APOBEC3G, and APOBEC3H demonstrate a conserved capacity to restrict Vif-deficient HIV-1.
21746770 2011 Core-APOBEC3C chimerical protein inhibits hepatitis B virus replication.
21632763 2011 Genetic editing of herpes simplex virus 1 and Epstein-Barr herpesvirus genomes by human APOBEC3 cytidine deaminases in culture and in vivo.
21496894 2011 Hydroxylation of 5-methylcytosine by TET1 promotes active DNA demethylation in the adult brain.
21430060 2011 Identification of a single amino acid required for APOBEC3 antiretroviral cytidine deaminase activity.
21368204 2011 Somatic hypermutation of human mitochondrial and nuclear DNA by APOBEC3 cytidine deaminases, a pathway for DNA catabolism.
20308164 2010 Quantitative profiling of the full APOBEC3 mRNA repertoire in lymphocytes and tissues: implications for HIV-1 restriction.
20096141 2010 Interactions of host APOBEC3 restriction factors with HIV-1 in vivo: implications for therapeutics.
20062055 2010 APOBEC3 proteins mediate the clearance of foreign DNA from human cells.
19911124 2009 APOBEC deaminases-mutases with defensive roles for immunity.
19581596 2009 Model structure of APOBEC3C reveals a binding pocket modulating ribonucleic acid interaction required for encapsidation.
19390611 2009 Are viruses inhibited by APOBEC3 molecules from their host species?
19369234 2009 Primary culture of human blood-retinal barrier cells and preliminary study of APOBEC3 expression: an in vitro study.
19088851 2008 Distinct determinants in HIV-1 Vif and human APOBEC3 proteins are required for the suppression of diverse host anti-viral proteins.
19074429 2009 Species-specific inhibition of APOBEC3C by the prototype foamy virus protein bet.
18702815 2008 Restriction by APOBEC3 proteins of endogenous retroviruses with an extracellular life cycle: ex vivo effects and in vivo "traces" on the murine IAPE and human HERV-K elements.
18555089 2008 APOBEC3 proteins and porcine endogenous retroviruses.
18448976 2008 Hepatitis B: modern concepts in pathogenesis--APOBEC3 cytidine deaminases as effectors in innate immunity against the hepatitis B virus.
18420796 2008 Hypermutation of hepatitis B virus genomes by APOBEC3G, APOBEC3C and APOBEC3H.
18419775 2008 Conserved and non-conserved features of HIV-1 and SIVagm Vif mediated suppression of APOBEC3 cytidine deaminases.
18391217 2008 Cytidine deamination induced HIV-1 drug resistance.
18304004 2008 The APOBEC3 cytidine deaminases: an innate defensive network opposing exogenous retroviruses and endogenous retroelements.
18032489 2008 Species-specific restriction of apobec3-mediated hypermutation.
17977970 2008 Human immunodeficiency virus type 1 Vif functionally interacts with diverse APOBEC3 cytidine deaminases and moves with them between cytoplasmic sites of mRNA metabolism.
17967058 2007 Target cell APOBEC3C can induce limited G-to-A mutation in HIV-1.
17672864 2008 Cytidine deaminase APOBEC3B interacts with heterogeneous nuclear ribonucleoprotein K and suppresses hepatitis B virus expression.
17625792 2007 Hepatitis B virus DNA is subject to extensive editing by the human deaminase APOBEC3C.
17582006 2007 Differential inhibition of long interspersed element 1 by APOBEC3 does not correlate with high-molecular-mass-complex formation or P-body association.
17371941 2007 Myeloid differentiation and susceptibility to HIV-1 are linked to APOBEC3 expression.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17078485 Human APOBEC3 proteins, retrovirus restriction, and HIV drug resistance.
16735504 2006 APOBEC3 proteins inhibit human LINE-1 retrotransposition.
16527742 2006 APOBEC3A is a potent inhibitor of adeno-associated virus and retrotransposons.
16060832 2005 Regulated production and anti-HIV type 1 activities of cytidine deaminases APOBEC3B, 3F, and 3G.
15956565 2005 Differential sensitivity of murine leukemia virus to APOBEC3-mediated inhibition is governed by virion exclusion.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466872 2004 APOBEC3B and APOBEC3C are potent inhibitors of simian immunodeficiency virus replication.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12859895 2003 Species-specific exclusion of APOBEC3G from HIV-1 virions by Vif.
12683974 2003 Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11863358 2002 An anthropoid-specific locus of orphan C to U RNA-editing enzymes on chromosome 22.
10591208 1999 The DNA sequence of human chromosome 22.
10469298 1999 Psoriasis upregulated phorbolin-1 shares structural but not functional similarity to the mRNA-editing protein apobec-1.