Property Summary

NCBI Gene PubMed Count 100
PubMed Score 95.62
PubTator Score 103.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung carcinoma 1.600 1.1e-23
psoriasis 1.400 7.9e-43

Gene RIF (101)

AA Sequence

MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMC      1 - 70
FLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRLSQ     71 - 140
AGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDPLVLR    141 - 210
RRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFIS    211 - 280
WSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVY    281 - 350
RQGCPFQPWDGLEEHSQALSGRLRAILQNQGN                                          351 - 382
//

Text Mined References (106)

PMID Year Title