Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.53
PubTator Score 12.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 3.9e-19
medulloblastoma, large-cell 6234 3.1e-03
gastric carcinoma 832 3.5e-02

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 3.1e-03
gastric carcinoma -2.100 3.5e-02
psoriasis -1.200 3.9e-19

Gene RIF (5)

PMID Text
21469143 Findings indicate that aberrant APOBEC2 expression causes nucleotide alterations in the transcripts of the specific target gene and could be involved in the development of human hepatocellular carcinoma through hepatic inflammation.
20138841 The APOBEC2 was confirmed to be elevated in the tonsils with IgAN patients, and the gene expression level was negatively related with serum IgG level in overall patients.
19911124 Studies indicate the APOBEC family consists of 11 members: APOBEC-1 (Apo1), APOBEC-2 (Apo2), activation induced cytidine deaminase (AID), APOBEC- 3A, -3B, -3C, -3DE, -3F, -3H (Apo3A-H) and APOBEC- 4 (Apo4).
18974842 Observational study of gene-disease association. (HuGE Navigator)
17187054 crystal structure of APOBEC2

AA Sequence

MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFL      1 - 70
CYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLS     71 - 140
KTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQE    141 - 210
NFLYYEEKLADILK                                                            211 - 224
//

Text Mined References (16)

PMID Year Title
21496894 2011 Hydroxylation of 5-methylcytosine by TET1 promotes active DNA demethylation in the adult brain.
21469143 2012 Excessive activity of apolipoprotein B mRNA editing enzyme catalytic polypeptide 2 (APOBEC2) contributes to liver and lung tumorigenesis.
20138841 2010 Microarray analysis of tonsils in immunoglobulin A nephropathy patients.
19911124 2009 APOBEC deaminases-mutases with defensive roles for immunity.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
17187054 2007 The APOBEC-2 crystal structure and functional implications for the deaminase AID.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12683974 2003 Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698249 2001 ARCD-1, an apobec-1-related cytidine deaminase, exerts a dominant negative effect on C to U RNA editing.
10403781 1999 APOBEC-2, a cardiac- and skeletal muscle-specific member of the cytidine deaminase supergene family.
8999814 1997 Tissue-specific inhibition of apolipoprotein B mRNA editing in the liver by adenovirus-mediated transfer of a dominant negative mutant APOBEC-1 leads to increased low density lipoprotein in mice.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8078915 1994 Dimeric structure of a human apolipoprotein B mRNA editing protein and cloning and chromosomal localization of its gene.