Property Summary

NCBI Gene PubMed Count 40
PubMed Score 96.34
PubTator Score 67.95

Knowledge Summary

Patent

No data available

Synonym

Accession P41238 Q9UE64 Q9UM71
Symbols BEDP
HEPR
CDAR1
APOBEC-1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (24)

AA Sequence

MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKF      1 - 70
TSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVT     71 - 140
IQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHL    141 - 210
QNCHYQTIPPHILLATGLIHPSVAWR                                                211 - 236
//

Text Mined References (40)

PMID Year Title