Property Summary

NCBI Gene PubMed Count 39
PubMed Score 92.20
PubTator Score 67.95

Knowledge Summary

Patent

No data available

Synonym

Accession P41238 Q9UE64 Q9UM71
Symbols BEDP
HEPR
CDAR1
APOBEC-1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Gene RIF (23)

PMID Text
26398702 AICDA/APOBEC family of cytidine deaminases is significant in innate immunity, as it restricts numerous viruses, including HBV, through hypermutationdependent and independent mechanisms. (Review)
25839328 An APOBEC-mediated mutational signature in 47% of 192 tumors suggests that APOBEC-catalyzed deamination provides a source of DNA damage in esophageal squamous cell carcinoma.
25100733 hnRNPQ6 is required for APOBEC1-enhanced IL8 production.
25085003 Results show that expression of APOBEC1 induces a mutator phenotype in 2 different cellular models.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20348446 The hypermutation activity of APOBEC-1 was decreased to background levels by a single point APOBEC-1 mutation of P29F or E181Q, while 50% of wild-type control editing at the normal site was retained.
20331378 Observational study of gene-disease association. (HuGE Navigator)
19965785 Identified two novel variants, rs1349411 (APOBEC1) and rs1424032, for serum apoB levels in Mexicans.
19932086 The data presented in this report suggested that similar regulatory mechanisms controlling the functional interaction of APOBEC-1 with ACF might be operational during enterocyte differentiation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911124 Studies indicate the APOBEC family consists of 11 members: APOBEC-1 (Apo1), APOBEC-2 (Apo2), activation induced cytidine deaminase (AID), APOBEC- 3A, -3B, -3C, -3DE, -3F, -3H (Apo3A-H) and APOBEC- 4 (Apo4).
18971252 HIV-1 Tat downregulates APOBEC1 in HEK 293T cells
18051367 HIV-1 Tat downregulates APOBEC1 in HEK 293T cells
17696929 Observational study of gene-disease association. (HuGE Navigator)
17696929 No evidence of association of APOBEC1 and PPARG with gallstone susceptibility was detected.
16999936 APOBEC3G is not a nucleo-cytoplasmic shuttling protein like APOBEC-1 and activation-induced cytidine deaminase
15979078 Expression of Apobec1 in HepG2 cells resulted in apoB mRNA editing, leading to decreased apoB100 abundance (to 6% of control) and the appearance of apoB48.
14559896 apobec-1-mediated apoB mRNA editing is regulated by BAG-4
12896982 apobec-1 complementation factor has a role in regulating nucleocytoplasmic import and shuttling
12881431 determination of multifunctional cycle and suppression of nonsense-mediated decay
11815617 expression of two proteins essential for apolipoprotein B mRNA editing from a single gene through alternative splicing
11727199 C-->U editing of neurofibromatosis 1 mRNA occurs in tumors that express both the type II transcript and apobec-1, the catalytic subunit of the apolipoprotein B mRNA-editing enzyme
9186903 Demonstrates the presence of a 36-aa peptide (isoform 2) derived from this gene in adult small intestinal villi using immunocytochemical analysis.

AA Sequence

MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKF      1 - 70
TSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVT     71 - 140
IQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHL    141 - 210
QNCHYQTIPPHILLATGLIHPSVAWR                                                211 - 236
//

Text Mined References (39)

PMID Year Title
26398702 2015 Associations between activation-induced cytidine deaminase/apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like cytidine deaminase expression, hepatitis B virus (HBV) replication and HBV-associated liver disease (Review).
25839328 2015 Genomic analyses reveal mutational signatures and frequently altered genes in esophageal squamous cell carcinoma.
25100733 2014 The RNA-editing enzyme APOBEC1 requires heterogeneous nuclear ribonucleoprotein Q isoform 6 for efficient interaction with interleukin-8 mRNA.
25085003 2014 The RNA editing enzyme APOBEC1 induces somatic mutations and a compatible mutational signature is present in esophageal adenocarcinomas.
22580899 2012 Proprotein convertase subtilisin/kexin type 9 interacts with apolipoprotein B and prevents its intracellular degradation, irrespective of the low-density lipoprotein receptor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20348446 2010 Hypermutation induced by APOBEC-1 overexpression can be eliminated.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
19965785 2010 Identification of two common variants contributing to serum apolipoprotein B levels in Mexicans.
19932086 2010 The expression of apoB mRNA editing factors is not the sole determinant for the induction of editing in differentiating Caco-2 cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911124 2009 APOBEC deaminases-mutases with defensive roles for immunity.
17696929 2007 Investigation of the Lith6 candidate genes APOBEC1 and PPARG in human gallstone disease.
16999936 2006 APOBEC-1 and AID are nucleo-cytoplasmic trafficking proteins but APOBEC3G cannot traffic.
15979078 2006 Simultaneous expression of apolipoprotein B mRNA editing enzyme and scavenger receptor BI mediated by a therapeutic gene expression system.
15659357 2005 NMR structure of the apoB mRNA stem-loop and its interaction with the C to U editing APOBEC1 complementary factor.
15516966 2004 Retroviral restriction by APOBEC proteins.
14559896 2003 Involvement of a chaperone regulator, Bcl2-associated athanogene-4, in apolipoprotein B mRNA editing.
12896982 2003 A novel nuclear localization signal in the auxiliary domain of apobec-1 complementation factor regulates nucleocytoplasmic import and shuttling.
12881431 2003 The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay.
12683974 2003 Messenger RNA editing in mammals: new members of the APOBEC family seeking roles in the family business.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11815617 2002 Two proteins essential for apolipoprotein B mRNA editing are expressed from a single gene through alternative splicing.
11727199 2002 C-->U editing of neurofibromatosis 1 mRNA occurs in tumors that express both the type II transcript and apobec-1, the catalytic subunit of the apolipoprotein B mRNA-editing enzyme.
11698249 2001 ARCD-1, an apobec-1-related cytidine deaminase, exerts a dominant negative effect on C to U RNA editing.
11584023 2001 A DnaJ protein, apobec-1-binding protein-2, modulates apolipoprotein B mRNA editing.
11577082 2001 Novel role for RNA-binding protein CUGBP2 in mammalian RNA editing. CUGBP2 modulates C to U editing of apolipoprotein B mRNA by interacting with apobec-1 and ACF, the apobec-1 complementation factor.
11352648 2001 Two-hybrid cloning identifies an RNA-binding protein, GRY-RBP, as a component of apobec-1 editosome.
10781591 2000 Purification and molecular cloning of a novel essential component of the apolipoprotein B mRNA editing enzyme-complex.
10669759 2000 Molecular cloning of apobec-1 complementation factor, a novel RNA-binding protein involved in the editing of apolipoprotein B mRNA.
9479499 1998 Human apolipoprotein B RNA editing deaminase gene (APOBEC1).
9186903 1997 Characterization of the human apobec-1 gene: expression in gastrointestinal tissues determined by alternative splicing with production of a novel truncated peptide.
8999814 1997 Tissue-specific inhibition of apolipoprotein B mRNA editing in the liver by adenovirus-mediated transfer of a dominant negative mutant APOBEC-1 leads to increased low density lipoprotein in mice.
8999813 1997 Cloning of an Apobec-1-binding protein that also interacts with apolipoprotein B mRNA and evidence for its involvement in RNA editing.
8692961 1996 Apolipoprotein B RNA editing enzyme-deficient mice are viable despite alterations in lipoprotein metabolism.
8208612 1994 Molecular cloning of a human small intestinal apolipoprotein B mRNA editing protein.
8078915 1994 Dimeric structure of a human apolipoprotein B mRNA editing protein and cloning and chromosomal localization of its gene.
7736571 1995 Evolutionary origins of apoB mRNA editing: catalysis by a cytidine deaminase that has acquired a novel RNA-binding motif at its active site.
7698776 1994 Assignment of the gene encoding the human apolipoprotein B mRNA editing enzyme (APOBEC1) to chromosome 12p13.1.