Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.04
PubTator Score 7.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.144 9.6e-05
esophageal adenocarcinoma 1.100 1.8e-02
psoriasis -1.400 2.8e-05
osteosarcoma -1.781 5.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.112 8.6e-04
acute quadriplegic myopathy 1.426 5.6e-08
pancreatic ductal adenocarcinoma liver m... -2.274 5.5e-04
diabetes mellitus -1.100 1.2e-02
subependymal giant cell astrocytoma -1.137 3.7e-03
ovarian cancer 3.000 7.2e-06
dermatomyositis 1.100 3.4e-04

Gene RIF (3)

PMID Text
25180020 APMAP is an endogenous suppressor of Abeta production in the brain.
22267596 C20orf3 mapping at chromosome 20p11 is associated with hepatic-specific metastasis in patients with colorectal cancer.
18513186 characterization of the gene product of open reading frame 3 encoded at human chromosome 20 (C20orf3), which represents a member of the lactonohydrolase super family

AA Sequence

MSEADGLRQRRPLRPQVVTDDDGQAPEAKDGSSFSGRVFRVTFLMLAVSLTVPLLGAMMLLESPIDPQPL      1 - 70
SFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPC     71 - 140
KTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGR    141 - 210
KIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMAR    211 - 280
IRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFS    281 - 350
QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV        351 - 416
//

Text Mined References (24)

PMID Year Title
26767403 2016 Identification of a Novel Function of Adipocyte Plasma Membrane-Associated Protein (APMAP) in Gestational Diabetes Mellitus by Proteomic Analysis of Omental Adipose Tissue.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25180020 2015 The adipocyte differentiation protein APMAP is an endogenous suppressor of A? production in the brain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22267596 2013 Chromosome 20p11 gains are associated with liver-specific metastasis in patients with colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
20552250 2010 Reconstruction of gene association network reveals a transmembrane protein required for adipogenesis and targeted by PPAR?.
19946888 2010 Defining the membrane proteome of NK cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18513186 2008 Localization and characterization of the novel protein encoded by C20orf3.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11583587 2001 Identification of a novel integral plasma membrane protein induced during adipocyte differentiation.
10945474 2000 Genomic construct and mapping of the gene for CMAP (leukocystatin/cystatin F, CST7) and identification of a proximal novel gene, BSCv (C20orf3).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.