Property Summary

NCBI Gene PubMed Count 62
PubMed Score 137.29
PubTator Score 84.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26313004 This paper demonstrates an important role for APLP2 in refractive development in mice and humans, suggesting a high level of evolutionary conservation of the signaling pathways underlying refractive eye development.
26085104 We conclude that PCSK9 enhances the degradation of the LDLR independently of either APLP2 or sortilin both ex vivo and in mice.
25683482 APLP1 and APLP2, behave similarly to APP in that they both associate with assembled NMDA receptors in the endoplasmic reticulum
25576918 Data show that amyloid precursor-like protein 2 (APLP2) expression is elevated in pancreatic cancer metastases.
23430252 amyloid precursor protein-like protein-2, but not amyloid precursor protein, is involved in mediating postendocytic delivery of PCSK9 to lysosomes and is therefore important for PCSK9 function
22797723 our discoveries establish a role for APLP2 in the growth of pancreatic cancer cells and show that inhibitors preventing APLP2 cleavage reduce the viability of pancreatic cancer cells.
22641691 Aberrant enhancement of YWK-II/APLP2 by nuclear export of Bat3 may play a role in cancer development by inhibiting cell apoptosis.
21952790 APP and its mammalian homologs, amyloid precursor-like proteins APLP1 and APLP2, participate under physiological conditions via trans-cellular dimerization in synaptogenesis.
21826533 Regulation of major histocompatibility complex class I molecule expression on cancer cells by amyloid precursor-like protein 2.
21695060 proteolytic cleavage sites of the amyloid precursor-like protein 2 by the proteases ADAM10, BACE1 and gamma-secretase
21178287 APLP-2 (and APLP1) are capable of activating gene transcription via binding to Mint3.
20732423 The interaction between APLP2 and ataxin-7 and proteolytic processing of APLP2 may contribute to the pathogenesis of spinocerebellar ataxia type 7.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19808674 APLP2 has a multistep trafficking function that influences the expression of major histocompatibility complex class I molecules at the plasma membrane
19126676 Coexpression of APP with APLP1 or APLP2 leads to diminished generation of Abeta42
18641335 APLP2 modulates the stability and endocytosis of K(d) molecules
18452037 APLP2/MHC association is influenced by multiple domains of the MHC class I heavy chain and by beta(2)m's effects on the conformation of the heavy chain.
17452623 YWK-II (APLP2 protein) is a G(o)-coupled receptor for Mullerian inhibiting substance in mediating ERK1/2 activation leading to anti-apoptotic activity or cell survival.
17405931 APLP2 and APP have roles in sperm function
16645641 findings show an increase in the immunoreactivities for the nuclear C-terminal fragments of APLP2 and for GSK-3beta in the brains of Alzheimer disease patients
16279945 APLP2 is shed by disintegrins and metalloproteinases. Overexpression of secretase or TACE in HEK293 cells increases the release of neurotrophic soluble APLP2 severalfold.
15584916 Interaction of human and murine Abeta peptides, Abeta40 and Abeta42. Interspecies Abeta aggregates and fibres are readily formed and are more stable than homogenous human fibres. (Amyloid beta 40 and 42)
15208260 The APLP2 gene has no CAGA box, but it does have a GAGA sequence in a location similar to that of the CAGA box in the APP gene.
14970212 APLP-1 and APLP-2 are processed by alpha- and gamma-secretase-like cleavages, and their intracellular domains can be released by cleavage at epsilon-sites. APLP-2 processing appears to be the most elaborate and to involve alternative cleavage sites.
14699153 APLP1 and APLP2 and APP are processed similarly to act via the same nuclear target and are regulated by BACE 1 in neurons
14597230 Sustained levels of APP and the elevated levels of APLP2, in spite of the reduced mRNA expression, are due to altered proteolytic processing of these proteins.
12595709 crystals of extracellular fragment X3 of a human sperm membrane protein YWK-II/APPH have been grow by the vapour-diffusion method [YWK-II PROTEIN]
12228233 APLP1 and APLP2 are processed by the gamma-secretase in a Presenilin 1-dependent manner and the extreme carboxyl-terminal fragments produced by this processing (APP-like Intracellular Domain are able to enhance Fe65-dependent gene activation

AA Sequence

MAATGTAAAAATGRLLLLLLVGLTAPALALAGYIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKW      1 - 70
EPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVS     71 - 140
DVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIG    141 - 210
SVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKG    211 - 280
DDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNF    281 - 350
ESEDYCMAVCKAMIPPTPLPTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAK    351 - 420
NLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPPRPHRIL    421 - 490
QALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEE    491 - 560
IDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMKKGSGVGE    561 - 630
QDGGLIGAEEKVINSKNKVDENMVIDETLDVKEMIFNAERVGGLEEERESVGPLREDFSLSSSALIGLLV    631 - 700
IAVAIATVIVISLVMLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTYKYLEQMQI           701 - 763
//

Text Mined References (69)

PMID Year Title
26313004 2015 APLP2 Regulates Refractive Error and Myopia Development in Mice and Humans.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26085104 2015 Amyloid Precursor-like Protein 2 and Sortilin Do Not Regulate the PCSK9 Convertase-mediated Low Density Lipoprotein Receptor Degradation but Interact with Each Other.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25683482 2015 APLP1 and APLP2, members of the APP family of proteins, behave similarly to APP in that they associate with NMDA receptors and enhance NMDA receptor surface expression.
25576918 2015 Amyloid precursor-like protein 2 (APLP2) affects the actin cytoskeleton and increases pancreatic cancer growth and metastasis.
23430252 2013 Characterization of proprotein convertase subtilisin/kexin type 9 (PCSK9) trafficking reveals a novel lysosomal targeting mechanism via amyloid precursor-like protein 2 (APLP2).
22797723 2012 Relevance of amyloid precursor-like protein 2 C-terminal fragments in pancreatic cancer cells.
22641691 2012 Regulation of apoptosis by Bat3-enhanced YWK-II/APLP2 protein stability.
21952790 2012 Structural aspects and physiological consequences of APP/APLP trans-dimerization.
21826533 2011 Regulation of major histocompatibility complex class I molecule expression on cancer cells by amyloid precursor-like protein 2.
21695060 2011 Determination of the proteolytic cleavage sites of the amyloid precursor-like protein 2 by the proteases ADAM10, BACE1 and ?-secretase.
21522131 2011 APP and APLP2 are essential at PNS and CNS synapses for transmission, spatial learning and LTP.
21459473 2012 The amyloid precursor protein and its homologues: structural and functional aspects of native and pathogenic oligomerization.
21293490 2011 Mediator is a transducer of amyloid-precursor-protein-dependent nuclear signalling.
21269460 2011 Initial characterization of the human central proteome.
21178287 2011 Signaling via amyloid precursor-like proteins APLP1 and APLP2.
20936779 2010 A human MAP kinase interactome.
20732423 2011 Amyloid precursor-like protein 2 cleavage contributes to neuronal intranuclear inclusions and cytotoxicity in spinocerebellar ataxia-7 (SCA7).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19946888 2010 Defining the membrane proteome of NK cells.
19808674 2009 Mechanism for amyloid precursor-like protein 2 enhancement of major histocompatibility complex class I molecule degradation.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19126676 2009 Subcellular localization and dimerization of APLP1 are strikingly different from APP and APLP2.
18641335 2008 Amyloid precursor-like protein 2 increases the endocytosis, instability, and turnover of the H2-K(d) MHC class I molecule.
18452037 2008 Specificity of amyloid precursor-like protein 2 interactions with MHC class I molecules.
17709753 2007 Amyolid precursor protein mediates presynaptic localization and activity of the high-affinity choline transporter.
17452623 2007 YWK-II protein as a novel G(o)-coupled receptor for Müllerian inhibiting substance in cell survival.
17405931 2007 Differential distribution of Alzheimer's amyloid precursor protein family variants in human sperm.
17371289 2007 The APP family of proteins: similarities and differences.
16645641 2007 Intracellular domains of amyloid precursor-like protein 2 interact with CP2 transcription factor in the nucleus and induce glycogen synthase kinase-3beta expression.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16279945 2005 Shedding of the amyloid precursor protein-like protein APLP2 by disintegrin-metalloproteinases.
16193067 2005 Homo- and heterodimerization of APP family members promotes intercellular adhesion.
15584916 2004 Interaction of human and mouse Abeta peptides.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15208260 2004 Presence of a "CAGA box" in the APP gene unique to amyloid plaque-forming species and absent in all APLP-1/2 genes: implications in Alzheimer's disease.
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
14983046 2004 Binding of F-spondin to amyloid-beta precursor protein: a candidate amyloid-beta precursor protein ligand that modulates amyloid-beta precursor protein cleavage.
14970212 2004 The proteolytic processing of the amyloid precursor protein gene family members APLP-1 and APLP-2 involves alpha-, beta-, gamma-, and epsilon-like cleavages: modulation of APLP-1 processing by n-glycosylation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699153 2004 Cleavage of amyloid-beta precursor protein and amyloid-beta precursor-like protein by BACE 1.
14597230 2003 Accumulation of the amyloid precursor-like protein APLP2 and reduction of APLP1 in retinoic acid-differentiated human neuroblastoma cells upon curcumin-induced neurite retraction.
12595709 2003 Crystallization and preliminary crystallographic analysis of extracellular fragment X3 of YWK-II/APPH: a human sperm membrane protein related to the Alzheimer betaA4-amyloid precursor protein.
12499552 2003 Crystallization and preliminary crystallographic analysis of a partial extracellular fragment of a sperm membrane protein YWK-II/APPH related to the Alzheimer betaA4-amyloid precursor protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12372026 2002 Identification and comparative analysis of differentially expressed proteins in rat striatum following 6-hydroxydopamine lesions of the nigrostriatal pathway: up-regulation of amyloid precursor-like protein 2 expression.
12228233 2002 Processing of beta-amyloid precursor-like protein-1 and -2 by gamma-secretase regulates transcription.
11443060 2001 A role for MAP kinase in regulating ectodomain shedding of APLP2 in corneal epithelial cells.
11101689 2000 Expression and characterization of the human YWK-II gene, encoding a sperm membrane protein related to the alzheimer betaA4-amyloid precursorprotein.
10702673 1999 Assignment of amyloid-precursor-like protein 2 gene (APLP2) to 11q24 by fluorescent in situ hybridization.
10490823 1999 Identification of a chromosome 3p14.3-21.1 gene, APPL, encoding an adaptor molecule that interacts with the oncoprotein-serine/threonine kinase AKT2.
10460257 1999 Disabled-1 binds to the cytoplasmic domain of amyloid precursor-like protein 1.
10081969 1999 Molecular cloning of human Fe65L2 and its interaction with the Alzheimer's beta-amyloid precursor protein.
9556595 1998 Post-translational processing and turnover kinetics of presynaptically targeted amyloid precursor superfamily proteins in the central nervous system.
9461550 1998 Fe65L2: a new member of the Fe65 protein family interacting with the intracellular domain of the Alzheimer's beta-amyloid precursor protein.
9109675 1997 Phosphorylation of Alzheimer beta-amyloid precursor-like proteins.
8894693 1996 cDNA cloning and chromosome mapping of the human Fe65 gene: interaction of the conserved cytoplasmic domains of the human beta-amyloid precursor protein and its homologues with the mouse Fe65 protein.
8855266 1996 Association of a novel human FE65-like protein with the cytoplasmic domain of the beta-amyloid precursor protein.
8485127 1993 Molecular cloning of the cDNA for a human amyloid precursor protein homolog: evidence for a multigene family.
8307156 1994 Expression, purification and characterization of a Kunitz-type protease inhibitor domain from human amyloid precursor protein homolog.
8220435 1993 Isolation and characterization of APLP2 encoding a homologue of the Alzheimer's associated amyloid beta protein precursor.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8020984 1994 The gene for the amyloid precursor-like protein APLP2 is assigned to human chromosome 11q23-q25.
7929392 1994 The amyloid beta-protein precursor and its mammalian homologues. Evidence for a zinc-modulated heparin-binding superfamily.
7702756 1994 A human amyloid precursor-like protein is highly homologous to a mouse sequence-specific DNA-binding protein.
7651835 1995 USF binds to the APB alpha sequence in the promoter of the amyloid beta-protein precursor gene.
7539437 1995 CDEBP, a site-specific DNA-binding protein of the 'APP-like' family, is required during the early development of the mouse.