Property Summary

NCBI Gene PubMed Count 22
PubMed Score 49.91
PubTator Score 32.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung carcinoma 2843 6.2e-27
osteosarcoma 7950 2.9e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Inhalation anthrax 5 4.082 2.0
Arts syndrome 26 3.109 1.6
Spondylolisthesis 22 3.074 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.600 6.2e-27
osteosarcoma -2.199 2.9e-08

Gene RIF (13)

AA Sequence

MSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTNPCFYQSSEKS      1 - 70
QLLPLKPNLWCYLNPGDSFSLLVDKYIFRILSIPSEVEMQCTLRNSQVLDEDNILNETPKSPVINLPHET     71 - 140
TGASQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNV    141 - 210
IQGSGKEEICKDKSQLNTTQQGRRQLISSGSSENTSAEQDTGEECKNTDQEESTISSKEMPQSFSAITLS    211 - 280
NTEMNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSN    281 - 350
PSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPE    351 - 420
CPYGPSCYRKNPQHKIEYRHNTLPVRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKE    421 - 490
DEEKEDVEELLKEAKRFMKRK                                                     491 - 511
//

Text Mined References (23)

PMID Year Title