Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.52
PubTator Score 10.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
cystic fibrosis 1670 0.0 2.0
Disease Target Count Z-score Confidence
Chromosome 17q11.2 deletion syndrome, 1.4Mb 14 4.447 2.2

Expression

Protein-protein Interaction (8)

Gene RIF (7)

PMID Text
24367089 APIP/MtnB functions as a cell death inhibitor independently of its MtnB enzyme activity for apoptosis induced by either hypoxia or etoposide, but dependently for caspase-1-induced pyroptosis
23285211 these results confirm the involvement of APIP in the methionine salvage pathway, which plays a key role in many biological functions like cancer, apoptosis, microbial proliferation and inflammation.
23192037 human APIP was overproduced in Escherichia coli, purified and crystallized. An X-ray diffraction data set was collected to 2.40 A resolution
22837397 A polymorphism associated with reduced expression of a putative methionine salvage pathway dehydratase, apoptotic protease activating factor 1 (APAF1)-interacting protein (APIP), was associated with increased caspase-1-mediated cell death in Salmonella.
22407486 The down-regulation of APIP and UACA expression suggests that the threshold to activate the apoptosome apparatus may be decreased in non-small cell lung cancer cells.
20800603 Observational study of gene-disease association. (HuGE Navigator)
15262985 APIP functions to inhibit muscle ischemic damage by binding to Apaf-1 in the Apaf-1/caspase-9 apoptosis pathway.

AA Sequence

MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP      1 - 70
EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM     71 - 140
IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLVRRHGVYVWGETWEKAKTM    141 - 210
CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV                                          211 - 242
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24367089 2014 Structural and biochemical basis for the inhibition of cell death by APIP, a methionine salvage enzyme.
23285211 2012 Functional identification of APIP as human mtnB, a key enzyme in the methionine salvage pathway.
23192037 2012 Crystallization and preliminary X-ray crystallographic analysis of human Apaf-1-interacting protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22837397 2012 Functional genetic screen of human diversity reveals that a methionine salvage enzyme regulates inflammatory cell death.
22407486 2012 Down-regulated expression of apoptosis-associated genes APIP and UACA in non-small cell lung carcinoma.
21602797 2011 Genome-wide association and linkage identify modifier loci of lung disease severity in cystic fibrosis at 11p13 and 20q13.2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19060904 2009 An empirical framework for binary interactome mapping.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15262985 2004 Induced inhibition of ischemic/hypoxic injury by APIP, a novel Apaf-1-interacting protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.