Property Summary

Ligand Count 9
NCBI Gene PubMed Count 514
PubMed Score 2988.98
PubTator Score 1193.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 1.200 1.1e-02
atypical teratoid / rhabdoid tumor 1.100 7.5e-08
glioblastoma 1.200 5.7e-03
group 3 medulloblastoma 1.400 1.3e-06
lung adenocarcinoma 1.196 7.3e-09
lung cancer 1.600 1.2e-04
medulloblastoma, large-cell 1.400 3.3e-06
Multiple myeloma 1.567 6.0e-04
oligodendroglioma 1.100 2.0e-02
ovarian cancer -1.500 6.5e-05
Waldenstrons macroglobulinemia 1.760 1.9e-03

Protein-protein Interaction (1)

PDB (22)

Gene RIF (488)

AA Sequence

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD      1 - 70
GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL     71 - 140
KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD    141 - 210
LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW    211 - 280
RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL                                    281 - 318
//

Text Mined References (527)

PMID Year Title