Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.8e-24
cystic fibrosis 1696 4.2e-07
ovarian cancer 8520 1.9e-02
interstitial cystitis 2312 3.8e-02

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.968 4.2e-07
interstitial cystitis 1.100 3.8e-02
ovarian cancer 1.200 1.9e-02
psoriasis 1.400 2.8e-24

Gene RIF (2)

AA Sequence

MRFQQFLFAFFIFIMSLLLISGQRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP                      1 - 54
//

Text Mined References (10)

PMID Year Title