Property Summary

NCBI Gene PubMed Count 28
PubMed Score 1141.67
PubTator Score 213.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.046 6.0e-03
psoriasis 2.000 1.9e-05
osteosarcoma -1.609 1.9e-05
pancreatic ductal adenocarcinoma liver m... -1.033 1.1e-02
lung cancer 1.300 3.7e-04
ovarian cancer 1.600 2.4e-05

Synonym

Accession P13798 Q9BQ33 Q9P0Y2 AARE
Symbols APH
OPH
AARE
ACPH
D3S48E
D3F15S2
DNF15S2

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
2143 summary 3 / 0 / 0 Summary of probe development efforts to identify inhibitors of Protein Phosphatase Methylesterase 1 (PME-1).
2366 confirmatory 10 / 0 / 16 Late stage results from the probe development effort to identify inhibitors of the protein methylesterase PME-1: Gel-based Activity-Based Protein Profiling (ABPP) IC50
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
743137 other 1 / 0 / 0 Late stage assay provider results from the extended probe development effort to identify inhibitors of LYPLA1 and LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis

Gene RIF (3)

PMID Text
21931648 Studies indicate that the cylindromatosis/turban tumor syndrome gene (CYLD) ranked highest, followed by acylaminoacyl-peptidase (APEH), dystroglycan (DAG1), macrophage-stimulating protein (MST1) and ubiquitin-specific peptidase 4 (USP4).
20529763 Observational study of gene-disease association. (HuGE Navigator)
20307617 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDLERMENIRFCRQYLVF      1 - 70
HDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSALEK     71 - 140
HGPVYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYE    141 - 210
DWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRS    211 - 280
ALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPR    281 - 350
QLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLM    351 - 420
VAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQ    421 - 490
PGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDV    491 - 560
KDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCV    561 - 630
VEAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLL    631 - 700
LYPKSTHALSEVEVESDSFMNAVLWLRTHLGS                                          701 - 732
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21931648 2011 Genetic evidence supporting the association of protease and protease inhibitor genes with inflammatory bowel disease: a systematic review.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21269460 2011 Initial characterization of the human central proteome.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20307617 2010 Association analysis of 3p21 with Crohn's disease in a New Zealand population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17241160 2007 Acyl peptide hydrolase, a serine proteinase isolated from conditioned medium of neuroblastoma cells, degrades the amyloid-beta peptide.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15862967 2005 Yeast two-hybrid identification of prostatic proteins interacting with human sex hormone-binding globulin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12000146 2002 Specific enhancement of acylase I and acylpeptide hydrolase activities by the corresponding N-acetylated substrates in primary rat hepatocyte cultures.
11921441 2002 Functional proteomics using microchannel plate detectors.
10719179 2000 Identification of oxidized protein hydrolase of human erythrocytes as acylpeptide hydrolase.
10407158 1999 Cloning, sequencing and further characterization of acylpeptide hydrolase from porcine intestinal mucosa.
10395453 1999 Structural investigations on human erythrocyte acylpeptide hydrolase by mass spectrometric procedures.
8724851 1996 The nucleotide sequence of human acylamino acid-releasing enzyme.
8411161 1993 Crystallization and preliminary X-ray studies of human erythrocyte acylpeptide hydrolase.
2565880 1989 The DNF15S2 locus at 3p21 is transcribed in normal lung and small cell lung cancer.
2392324 1990 A gene near the D3F15S2 site on 3p is expressed in normal human kidney but not or only at a severely reduced level in 11 of 15 primary renal cell carcinomas (RCC).
2006156 1991 Genetic relationship between acylpeptide hydrolase and acylase, two hydrolytic enzymes with similar binding but different catalytic specificities.
1861871 1991 The gene from the short arm of chromosome 3, at D3F15S2, frequently deleted in renal cell carcinoma, encodes acylpeptide hydrolase.
1740429 1992 Acylpeptide hydrolase: inhibitors and some active site residues of the human enzyme.
1550126 1992 The human loci DNF15S2 and D3S94 have a high degree of sequence similarity to acyl-peptide hydrolase and are located at 3p21.3.
1521574 1992 Description of an acylpeptide hydrolase from lens.