Property Summary

Ligand Count 1
NCBI Gene PubMed Count 30
PubMed Score 1179.06
PubTator Score 213.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.300 3.7e-04
Multiple myeloma 1.046 6.0e-03
osteosarcoma -1.609 1.9e-05
ovarian cancer 1.600 2.4e-05
pancreatic ductal adenocarcinoma liver m... -1.033 1.1e-02
psoriasis 2.000 1.9e-05

Gene RIF (5)

AA Sequence

MERQVLLSEPEEAAALYRGLSRQPALSAACLGPEVTTQYGGQYRTVHTEWTQRDLERMENIRFCRQYLVF      1 - 70
HDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGTGPGEEKQFLEVWEKNRKLKSFNLSALEK     71 - 140
HGPVYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTKALDVSASDDEIARLKKPDQAIKGDQFVFYE    141 - 210
DWGENMVSKSIPVLCVLDVESGNISVLEGVPENVSPGQAFWAPGDAGVVFVGWWHEPFRLGIRFCTNRRS    211 - 280
ALYYVDLIGGKCELLSDDSLAVSSPRLSPDQCRIVYLQYPSLIPHHQCSQLCLYDWYTKVTSVVVDVVPR    281 - 350
QLGENFSGIYCSLLPLGCWSADSQRVVFDSAQRSRQDLFAVDTQVGTVTSLTAGGSGGSWKLLTIDQDLM    351 - 420
VAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQ    421 - 490
PGSPPDKTQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFGQDSILSLPGNVGHQDV    491 - 560
KDVQFAVEQVLQEEHFDASHVALMGGSHGGFISCHLIGQYPETYRACVARNPVINIASMLGSTDIPDWCV    561 - 630
VEAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLL    631 - 700
LYPKSTHALSEVEVESDSFMNAVLWLRTHLGS                                          701 - 732
//

Text Mined References (37)

PMID Year Title