Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.04
PubTator Score 10.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma -1.100 6.3e-03
oligodendroglioma 1.200 4.7e-02
psoriasis -3.600 5.2e-06
osteosarcoma -3.270 8.8e-10
chronic lymphosyte leukemia 1.200 4.8e-04
tuberculosis and treatment for 6 months 1.400 1.8e-02
primary pancreatic ductal adenocarcinoma 1.425 2.1e-02
intraductal papillary-mucinous adenoma (... 1.600 3.1e-03
lung cancer -1.200 2.0e-02
group 3 medulloblastoma -1.300 3.4e-03
subependymal giant cell astrocytoma -1.854 4.5e-02
Pick disease -1.100 7.5e-05
ovarian cancer -2.100 3.3e-07
pancreatic cancer 1.100 1.6e-02

Synonym

Accession Q92870 B4DSL4 E9PG87 Q8IUI6
Symbols FE65L
FE65L1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Pathway (1)

Gene RIF (12)

PMID Text
27157394 APBB2 was differentially expressed between Fibromyalgia patients and healthy controls.
26194614 results provide additional evidence of a genetic interaction between GSK3beta and APBB2 and further suggest that GSK3beta is involved in the pathophysiology of both of the primary neuropathologies of Alzheimer's disease
23384821 The APBB2 rs13133980 G allele was over-represented in centenarians with severe cognitive impairment compared to individuals without this disability.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19542221 The differential processing of amyloid-beta precursor via secretase enzymes regulates the proliferation and differentiation of human embryonic stem cell.
18852029 The hCV1558625 G allele was over-represented in patients with onset under age 70 compared to controls in the same age range.
18852029 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17567906 In response to TNF, Zfra is upregulated and modulates TNF-mediated cell death via interacting with TRADD, FADD and RIP (death-inducing signaling complex) at the receptor level, and downstream effectors NF-kappaB, p53, WOX1, and JNK1.
16083851 the apoptosis inhibitory domain of FE65-like protein 1 regulates both apoptotic and caspase-independent programmed cell death mediated by TNF
15714520 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15714520 rs13133980 associated significantly with age of onset in Alzheimer disease. Genetic variations in APBB2 may affect late onset AD susceptibility.
14527950 FE65L1 potentiates gamma-secretase processing of APP CTFs. This requires binding of FE65L1 to APP and APP CTFs. Enhanced APP CTF processing can be detected in early endosome vesicles

AA Sequence

MSEVLPADSGVDTLAVFMASSGTTDVTNRNSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKY      1 - 70
ALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQDPNKNLSPTAVINITSEKLEGKEP     71 - 140
HPQDSSSCEILPSQPRRTKSFLNYYADLETSARELEQNRGNHHGTAEEKSQPVQGQASTIIGNGDLLLQK    141 - 210
PNRPQSSPEDGQVATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDETDI    211 - 280
WSDHSFQTDPDLPPGWKRVSDIAGTYYWHIPTGTTQWERPVSIPADLQGSRKGSLSSVTPSPTPENEKQP    281 - 350
WSDFAVLNGGKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKLRNAPHPDDDDSCSINSDPEAKCFA    351 - 420
VRSLGWVEMAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVL    421 - 490
HSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALAC    491 - 560
SSLQERANVNLDVPLQVDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNM    561 - 630
NVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQA    631 - 700
ACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP                701 - 758
//

Text Mined References (30)

PMID Year Title
27157394 Genome-wide expression profiling in the peripheral blood of patients with fibromyalgia.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26194614 2015 GSK3? Interactions with Amyloid Genes: An Autopsy Verification and Extension.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24143882 2014 Genome-wide association study of opioid dependence: multiple associations mapped to calcium and potassium pathways.
23384821 2013 APBB2 genetic polymorphisms are associated with severe cognitive impairment in centenarians.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19542221 2009 Differential processing of amyloid-beta precursor protein directs human embryonic stem cell proliferation and differentiation into neuronal precursor cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18852029 2008 Analysis of APBB2 gene polymorphisms in sporadic Alzheimer's disease.
17567906 2007 Zfra affects TNF-mediated cell death by interacting with death domain protein TRADD and negatively regulates the activation of NF-kappaB, JNK1, p53 and WOX1 during stress response.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16083851 2005 The apoptosis inhibitory domain of FE65-like protein 1 regulates both apoptotic and caspase-independent programmed cell death mediated by tumor necrosis factor.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15714520 2005 Genetic association of the APP binding protein 2 gene (APBB2) with late onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14527950 2003 Generation of the beta-amyloid peptide and the amyloid precursor protein C-terminal fragment gamma are potentiated by FE65L1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12089154 2002 Fe65, a ligand of the Alzheimer's beta-amyloid precursor protein, blocks cell cycle progression by down-regulating thymidylate synthase expression.
9585438 1998 Mapping of the human and murine X11-like genes (APBA2 and apba2), the murine Fe65 gene (Apbb1), and the human Fe65-like gene (APBB2): genes encoding phosphotyrosine-binding domain proteins that interact with the Alzheimer's disease amyloid precursor protein.
8955346 1996 The intracellular cytoplasmic domain of the Alzheimer's disease amyloid precursor protein interacts with phosphotyrosine-binding domain proteins in the yeast two-hybrid system.
8855266 1996 Association of a novel human FE65-like protein with the cytoplasmic domain of the beta-amyloid precursor protein.