Property Summary

NCBI Gene PubMed Count 84
PubMed Score 219.25
PubTator Score 103.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.600 3.6e-06
osteosarcoma 1.333 3.3e-05
glioblastoma -1.300 4.1e-05
atypical teratoid / rhabdoid tumor -1.400 8.6e-08
medulloblastoma, large-cell -1.300 4.5e-06
pediatric high grade glioma -1.300 2.3e-06
sonic hedgehog group medulloblastoma -1.100 2.7e-04
subependymal giant cell astrocytoma -1.395 2.2e-02
lung carcinoma 1.300 1.7e-20

Gene RIF (49)

PMID Text
26276215 Jagged1 is a novel binding partner of Fe65, and Fe65 may act as a novel effector of Jagged1 signaling.
26188042 FE65 influences APP degradation via the proteasome, and phosphorylation of FE65 Ser(610) by SGK1 regulates binding of FE65 to APP, APP turnover and processing.
26166158 Targeted enhancement of the signaling through the Fe65-cortactin pathway, by either HDAC6 inhibition or Tip60 activation, may lead to the development of new therapeutic drugs that are effective for patients with metastatic breast cancers.
25397632 A novel phosphorylation site was identified within Fe65 which mediates gene transcription.
24619425 Data indicate that Fe65 is a positive estrogen receptor alpha (ERalpha) transcriptional regulator.
24284412 The SV2A/FE65 interaction might play a role in synaptic signal transduction.
23572515 FE65 interactions with BLM and MCM proteins may contribute to the neuronal cell cycle re-entry observed in brains affected by Alzheimer's disease.
22902274 A ternary complex consisting of AICD, FE65, and TIP60 down-regulates Stathmin1.
22199353 Fe65 carries out different functions depending on its location in the regulation of Notch1 signaling.
21968187 Phosphorylation of LRP1 regulates the interaction with Fe65.
21824145 A novel FE65 isoform and the regulation of the splicing events leading to its production may contribute to elucidating neuronal specific roles of FE65 and its contribution to Alzheimer's disease pathology.
21650223 Fe65 binds preferentially to low-density lipoprotein receptor-related protein (LRP) carboxyl terminus when phosphorylated at tyrosine-4507 and in complex with amyloid precursor protein (APP).
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568118 Fe65 and Dab1 compete for binding to APP. Dab1 significantly decreased the amount of APP bound to LRP and the level of secreted APP and APP-CTF in LRP expressing cells
20405578 The data of this demonstrated that the induction of AICD/Fe65 or transgelin significantly alters actin dynamics and mitochondrial function in neuronal cells
20133016 Both amyloid-beta precursor protein and Fe65 are co-localized in model Hirano bodies associated with Alzheimer's disease.
20091743 reduced levels of Sp1 resulted in downregulation of endogenous FE65 mRNA and protein
19913121 Observational study of gene-disease association. (HuGE Navigator)
19381069 The protein-protein interaction between the WW domain of Fe65 and the putative binding motif of Nedd4-2 down-regulates Fe65 protein stability and subcellular localization through its ubiquitylation, to contribute to cell apoptosis.
18922798 Dexras1 functions as a suppressor of FE65-APP-mediated transcription, and FE65 tyrosine 547 phosphorylation enhances FE65-APP-mediated transcription, at least in part, by modulating the interaction between FE65 and Dexras1
18833287 Study determined the crystal structure of the carboxy-terminal APP intracellular domain in complex with the C-terminal phosphotyrosine-binding (PTB) domain of Fe65; The unique interface involves the NPxY PTB-binding motif and two alpha helices.
18800165 the beta-sheet edge in some natively folded amyloid oligomers is designed positively to prevent beta aggregation
18777128 Single nucleotide polymorphisms in APBB1 gene is associated with nicotine dependence.
18777128 Observational study of gene-disease association. (HuGE Navigator)
18550529 crystallographic analysis of the human Fe65-phosphotyrosine domain
18480379 Thyroid cancers are characterized by APP upregulation, increased membrane targeting of the APP ectodomain and significantly increased mRNA levels of the APP scaffold proteins JIP1, ShcA and Fe65.
18468999 APP-regulated FE65 plays an important role in the early stress response of cells and that FE65 deregulated from APP induces apoptosis.
17855370 Fe65 regulation of APP proteolysis may be integrally associated with its nuclear signaling function, as all antecedent proteolytic steps prior to release of Fe65 from the membrane are fostered by the APP-Fe65 interaction
17854420 Meta-analysis of gene-disease association. (HuGE Navigator)
17686488 Results describe the crystal structures of the human FE65 WW domain (residues 253-289) in the apo form and bound to the peptides PPPPPPLPP and PPPPPPPPPL, which correspond to human Mena residues 313-321 and 347-356, respectively.
17590240 We demonstrated that treatment with EGCG reduced the A beta levels by enhancing endogenous APP nonamyloidogenic proteolytic processing.
17512906 Nek6 binds to Fe65 through its (267)PPLP(270) motif; the protein-protein interaction between Nek6 and Fe65 regulates their subcellular localization and cell apoptosis
17368826 Notch1 intracellular domain plays the role of a negative regulator in AICD signaling via the disruption of the AICD-Fe65-Tip60 trimeric complex.
16332686 FE65 is the key agent of Gal4DB-mediated transcriptional transactivation, whereas Tip60 is an FE65-associated repressor.
16223726 multiple interactions of AICD with FE65 and 14-3-3gamma modulate FE65-dependent gene transactivation
15816856 The present work provides evidence that FE65 plays a role in the regulation of amyloid precursor protein processing in an in vivo transgenic mouse model.
15647266 p65FE65 may be an intracellular mediator in a signaling cascade regulating alpha-secretion of APP
15044485 Fe65 is activated by the APP intracellular domain during transcriptional transactivation
15037614 Alcadein and amyloid beta-protein precursor regulates FE65-dependent gene transactivation
14569203 Abnormal accumulations of the amyloid-beta precursor protein associated with the aging cellular muscle fibers and appear to be the key pathogenic event in iclusion-body myositis.
12888553 APP and Fe65 mediate transactivation with low density lipoprotein receptor-related protein
12779321 gamma-Secretase cleavage and binding to FE65 regulate the nuclear translocation of the intracellular C-terminal domain (ICD) of the APP family of proteins.
12727304 Observational study of gene-disease association. (HuGE Navigator)
12727304 Adjusting for age and sex, we found a slight risk associated with the deletion in intron 13 of the APBB1 gene for subjects less than 65 years.
12653567 The transcriptional activity of the APP intracellular domain-Fe65 complex is inhibited by activation of the NF-kappaB pathway.
11436125 Observational study of gene-disease association. (HuGE Navigator)
11099823 Observational study of gene-disease association. (HuGE Navigator)
11065130 Observational study of gene-disease association. (HuGE Navigator)
11029529 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGEGGGPEPGPANAKWL      1 - 70
KEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSELELSAHNAANRGLRGPGLIIS     71 - 140
TQEQGPDEGEEKAAGEAEEEEEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPREHSKSASLLF    141 - 210
GMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW    211 - 280
EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEP    281 - 350
LPQEEEKLPPRNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK    351 - 420
DLLLQLEDETLKLVEPQSQALLHAQPIISIRVWGVGRDSGRERDFAYVARDKLTQMLKCHVFRCEAPAKN    421 - 490
IATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVD    491 - 560
VINGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPA    561 - 630
SFCCHMFWCEPNAASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSL    631 - 700
KPKRLGAHTP                                                                701 - 710
//

Text Mined References (88)

PMID Year Title
26276215 2015 Fe65 negatively regulates Jagged1 signaling by decreasing Jagged1 protein stability through the E3 ligase Neuralized-like 1.
26188042 2015 Phosphorylation of FE65 Ser610 by serum- and glucocorticoid-induced kinase 1 modulates Alzheimer's disease amyloid precursor protein processing.
26166158 2015 Fe65 Suppresses Breast Cancer Cell Migration and Invasion through Tip60 Mediated Cortactin Acetylation.
25397632 2015 Fe65 Ser228 is phosphorylated by ATM/ATR and inhibits Fe65-APP-mediated gene transcription.
24619425 2014 A novel function of the Fe65 neuronal adaptor in estrogen receptor action in breast cancer cells.
24284412 2014 Amyloid beta a4 precursor protein-binding family B member 1 (FE65) interactomics revealed synaptic vesicle glycoprotein 2A (SV2A) and sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (SERCA2) as new binding proteins in the human brain.
24056087 2014 FE65 interacts with ADP-ribosylation factor 6 to promote neurite outgrowth.
23572515 2013 FE65 regulates and interacts with the Bloom syndrome protein in dynamic nuclear spheres - potential relevance to Alzheimer's disease.
22902274 2013 A ternary complex consisting of AICD, FE65, and TIP60 down-regulates Stathmin1.
22199353 2012 Dual regulation of notch1 signaling pathway by adaptor protein fe65.
21968187 2011 Phosphorylation of LRP1 regulates the interaction with Fe65.
21824145 2011 Identification and characterization of a neuronal enriched novel transcript encoding the previously described p60Fe65 isoform.
21650223 2011 Protein interactions among Fe65, the low-density lipoprotein receptor-related protein, and the amyloid precursor protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568118 2010 Dab1 binds to Fe65 and diminishes the effect of Fe65 or LRP1 on APP processing.
20405578 2010 The amyloid precursor protein intracellular domain(AICD) disrupts actin dynamics and mitochondrial bioenergetics.
20133016 2011 Association of AICD and Fe65 with Hirano bodies reduces transcriptional activation and initiation of apoptosis.
20091743 2010 Transcriptional regulation of human FE65, a ligand of Alzheimer's disease amyloid precursor protein, by Sp1.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19381069 2009 Ubiquitylation of Fe65 adaptor protein by neuronal precursor cell expressed developmentally down regulated 4-2 (Nedd4-2) via the WW domain interaction with Fe65.
19343227 2009 FE65 binds Teashirt, inhibiting expression of the primate-specific caspase-4.
19234442 2009 Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions.
18922798 2008 Dexras1 interacts with FE65 to regulate FE65-amyloid precursor protein-dependent transcription.
18833287 2008 Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
18800165 2008 Amyloid oligomer conformation in a group of natively folded proteins.
18777128 2008 Association of amyloid precursor protein-binding protein, family B, member 1 with nicotine dependence in African and European American smokers.
18550529 2008 Crystal structure of the human Fe65-PTB1 domain.
18480379 2008 Evidence for a role of the amyloid precursor protein in thyroid carcinogenesis.
18468999 2008 Regulation of FE65 nuclear translocation and function by amyloid beta-protein precursor in osmotically stressed cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17855370 2007 Fe65 stimulates proteolytic liberation of the beta-amyloid precursor protein intracellular domain.
17854420 2008 Meta-analysis of genetic variability in the beta-amyloid production, aggregation and degradation metabolic pathways and the risk of Alzheimer's disease.
17686488 2007 Structural basis for polyproline recognition by the FE65 WW domain.
17590240 2009 Epigallocatechin gallate (EGCG) suppresses beta-amyloid-induced neurotoxicity through inhibiting c-Abl/FE65 nuclear translocation and GSK3 beta activation.
17512906 2007 Human NIMA-related kinase 6 is one of the Fe65 WW domain binding proteins.
17368826 2007 Notch1 intracellular domain suppresses APP intracellular domain-Tip60-Fe65 complex mediated signaling through physical interaction.
17332754 2007 The novel cargo Alcadein induces vesicle association of kinesin-1 motor components and activates axonal transport.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16332686 2006 A dominant role for FE65 (APBB1) in nuclear signaling.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16223726 2005 Role of 14-3-3gamma in FE65-dependent gene transactivation mediated by the amyloid beta-protein precursor cytoplasmic fragment.
16049941 2005 A pilot proteomic study of amyloid precursor interactors in Alzheimer's disease.
15816856 2005 Expression of human FE65 in amyloid precursor protein transgenic mice is associated with a reduction in beta-amyloid load.
15647266 2005 Endoproteolytic cleavage of FE65 converts the adaptor protein to a potent suppressor of the sAPPalpha pathway in primates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
15044485 2004 Dissection of amyloid-beta precursor protein-dependent transcriptional transactivation.
15037614 2004 Coordinated metabolism of Alcadein and amyloid beta-protein precursor regulates FE65-dependent gene transactivation.
15031292 2004 The c-Abl tyrosine kinase phosphorylates the Fe65 adaptor protein to stimulate Fe65/amyloid precursor protein nuclear signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14572442 2003 Functional gamma-secretase complex assembly in Golgi/trans-Golgi network: interactions among presenilin, nicastrin, Aph1, Pen-2, and gamma-secretase substrates.
14569203 2003 Proposed pathogenetic cascade of inclusion-body myositis: importance of amyloid-beta, misfolded proteins, predisposing genes, and aging.
12972431 2003 Novel cadherin-related membrane proteins, Alcadeins, enhance the X11-like protein-mediated stabilization of amyloid beta-protein precursor metabolism.
12888553 2003 The intracellular domain of the low density lipoprotein receptor-related protein modulates transactivation mediated by amyloid precursor protein and Fe65.
12843239 2003 The amyloid precursor protein and its regulatory protein, FE65, in growth cones and synapses in vitro and in vivo.
12779321 2003 gamma-Secretase cleavage and binding to FE65 regulate the nuclear translocation of the intracellular C-terminal domain (ICD) of the APP family of proteins.
12727304 2003 A risk for early-onset Alzheimer's disease associated with the APBB1 gene (FE65) intron 13 polymorphism.
12653567 2003 The transcriptional activity of the APP intracellular domain-Fe65 complex is inhibited by activation of the NF-kappaB pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12150997 2002 Exchange of N-CoR corepressor and Tip60 coactivator complexes links gene expression by NF-kappaB and beta-amyloid precursor protein.
12089154 2002 Fe65, a ligand of the Alzheimer's beta-amyloid precursor protein, blocks cell cycle progression by down-regulating thymidylate synthase expression.
11854179 2002 A candidate molecular mechanism for the association of an intronic polymorphism of FE65 with resistance to very late onset dementia of the Alzheimer type.
11741599 2001 Multiple interactions of the cytosolic polyproline region of the CD95 ligand: hints for the reverse signal transduction capacity of a death factor.
11606623 2001 Demonstration by fluorescence resonance energy transfer of two sites of interaction between the low-density lipoprotein receptor-related protein and the amyloid precursor protein: role of the intracellular adapter protein Fe65.
11517249 2001 c-Jun N-terminal kinase (JNK)-interacting protein-1b/islet-brain-1 scaffolds Alzheimer's amyloid precursor protein with JNK.
11441186 2001 A transcriptionally [correction of transcriptively] active complex of APP with Fe65 and histone acetyltransferase Tip60.
11436125 2001 Lack of replication of association findings in complex disease: an analysis of 15 polymorphisms in prior candidate genes for sporadic Alzheimer's disease.
11279131 2001 The beta-amyloid precursor protein APP is tyrosine-phosphorylated in cells expressing a constitutively active form of the Abl protoncogene.
11099823 2000 Evidence against association of the FE65 gene (APBB1) intron 13 polymorphism in Alzheimer's patients.
11095528 2000 Fe65 and X11beta co-localize with and compete for binding to the amyloid precursor protein.
11085987 2001 The beta-amyloid precursor protein functions as a cytosolic anchoring site that prevents Fe65 nuclear translocation.
11065130 2000 A FE65 polymorphism associated with risk of developing sporadic late-onset alzheimer's disease but not with Abeta loading in brains.
11029529 2000 No association between an intronic biallelic polymorphism of the FE65 gene and Alzheimer's disease.
10945997 2000 cAMP-dependent protein kinase phosphorylation of EVL, a Mena/VASP relative, regulates its interaction with actin and SH3 domains.
10561691 1999 Alternatively spliced isoforms of FE65 serve as neuron-specific and non-neuronal markers.
10075692 1999 Regulation of beta-amyloid secretion by FE65, an amyloid protein precursor-binding protein.
9837937 1998 Interaction of cytosolic adaptor proteins with neuronal apolipoprotein E receptors and the amyloid precursor protein.
9799084 1998 The human FE65 gene: genomic structure and an intronic biallelic polymorphism associated with sporadic dementia of the Alzheimer type.
9738440 1998 Fe65 and the protein network centered around the cytosolic domain of the Alzheimer's beta-amyloid precursor protein.
9685356 1998 The Fe65 adaptor protein interacts through its PID1 domain with the transcription factor CP2/LSF/LBP1.
9585438 1998 Mapping of the human and murine X11-like genes (APBA2 and apba2), the murine Fe65 gene (Apbb1), and the human Fe65-like gene (APBB2): genes encoding phosphotyrosine-binding domain proteins that interact with the Alzheimer's disease amyloid precursor protein.
9461550 1998 Fe65L2: a new member of the Fe65 protein family interacting with the intracellular domain of the Alzheimer's beta-amyloid precursor protein.
9407065 1997 The WW domain of neural protein FE65 interacts with proline-rich motifs in Mena, the mammalian homolog of Drosophila enabled.
9045663 1997 Interaction of the phosphotyrosine interaction/phosphotyrosine binding-related domains of Fe65 with wild-type and mutant Alzheimer's beta-amyloid precursor proteins.
8955346 1996 The intracellular cytoplasmic domain of the Alzheimer's disease amyloid precursor protein interacts with phosphotyrosine-binding domain proteins in the yeast two-hybrid system.
8894693 1996 cDNA cloning and chromosome mapping of the human Fe65 gene: interaction of the conserved cytoplasmic domains of the human beta-amyloid precursor protein and its homologues with the mouse Fe65 protein.
8887653 1996 The phosphotyrosine interaction domains of X11 and FE65 bind to distinct sites on the YENPTY motif of amyloid precursor protein.