Property Summary

NCBI Gene PubMed Count 44
PubMed Score 41.37
PubTator Score 39.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.900 1.7e-03
cystic fibrosis 1.309 7.0e-05
ependymoma -1.600 3.9e-08
glioblastoma -1.300 4.9e-05
group 3 medulloblastoma -1.100 3.0e-03
lung cancer 2.000 5.1e-05
malignant mesothelioma -3.000 3.9e-08
medulloblastoma, large-cell -1.200 7.1e-05
osteosarcoma -1.958 4.6e-04
ovarian cancer 1.100 2.2e-07
pediatric high grade glioma -1.600 7.7e-05
Pick disease -1.200 5.6e-03
pituitary cancer -1.200 2.0e-03

Gene RIF (18)

AA Sequence

MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDG      1 - 70
DSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEEYLAHSAHPVDTDECQEAVEE     71 - 140
WTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQEEDGHYCASKEGYQDYYPEEANGNTGASPY    141 - 210
RLRRGDGDLEDQEEDIDQIVAEIKMSLSMTSITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEAR    211 - 280
PKSLNLLPEAKHPGDPQRGFKPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVAS    281 - 350
FPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSE    351 - 420
GDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGA    421 - 490
QEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHF    491 - 560
SNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLP    561 - 630
LATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRI    631 - 700
IEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI                         701 - 749
//

Text Mined References (48)

PMID Year Title