Property Summary

NCBI Gene PubMed Count 41
PubMed Score 44.88
PubTator Score 39.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -3.000 3.9e-08
glioblastoma -1.900 1.7e-04
osteosarcoma -1.958 4.6e-04
ependymoma -1.600 3.9e-08
cystic fibrosis 1.309 7.0e-05
atypical teratoid / rhabdoid tumor -1.900 1.7e-03
medulloblastoma, large-cell -1.200 7.1e-05
lung cancer 2.000 5.1e-05
pediatric high grade glioma -1.600 7.7e-05
group 3 medulloblastoma -1.100 3.0e-03
Pick disease -1.200 5.6e-03
ovarian cancer 1.300 3.5e-05
pituitary cancer -1.200 2.0e-03

Synonym

Accession Q99767 E9PGI4 O60571 Q5XKC0
Symbols X11L
MINT2
LIN-10
HsT16821
X11-BETA
D15S1518E
MGC:14091

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (18)

PMID Text
24742670 Mints are necessary for activity-induced APP and PS1 trafficking and provide insight into the cellular fate of APP in endocytic pathways essential for Abeta production.
24385013 Aberrant MINT2 methylation in body fluids may predict peritoneal micrometastasis for gastric cancer (GC) patients, which is a potential poor prognostic factor in GC.
23076970 a significant difference was shown for APBA2 gene expression of peripheral lymphocytes between Chinese Han Tourette syndrome (TS) group and healthy controls idicating the APBA2 gene is a promising peripheral blood biomarker that discriminates between patients with TS and healthy subjects
22222501 Amyloid beta A4 precursor protein-binding family A member 2 contains a potent neuronal promoter whose activity may be regulated by DNA methylation and glucocorticoid receptor [alpha], paired box protein 5.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029827 The co-occurrence of two nonsynonymous mutations in both affected siblings in a single family, each transmitted from a different unaffected parent, suggest a role for APBA2 mutations in rare individuals with ASD.
20029827 Observational study of gene-disease association. (HuGE Navigator)
20016085 Interaction of transcriptional coactivators with Mint1 or Mint2 prevents nuclear localization and transactivation of the transduction network mediated by amyloid precursor protein.
20015385 APBA2 were genes activated in early endometrial endometrioid carcinoma (stages I-II).
19744962 X11beta-mediated reduction in cerebral Abeta is associated with cognition and long-term potentiation in Alzheimer's disease APPswe transgenic mice.
19736351 Observational study of gene-disease association. (HuGE Navigator)
19222704 Phosphorylation of amino acids Ser236 and Ser238 in the X11L regulatory region are critical for increasing association of X11L and amyloid beta-protein precursor and are conserved in X11, a neuronal X11 family protein, but not in non-neuronal X11L2.
19197363 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17989066 Comparative genome hybridization suggests a role for NRXN1 and APBA2 in schizophrenia.
15699037 X11alpha and X11beta have roles in beta-amyloid precursor protein processing
14970211 This protein, which is a member of the mammalian LIN-10 protein family and a possible regulator of Abeta production, elevated APP and APLP2 phosphorylation
12780348 hXB51 isoforms regulate Abeta generation differently, either enhancing it by modifying the association of X11L with APP or suppressing it in an X11L-independent manner
12720574 The APBA2 gene has been found to map to a more telomeric location in chromosome 15q13 than previously found, and is partially duplicated within the broader region located approximately 5 Mb distal to the intact locus.

AA Sequence

MAHRKLESVGSGMLDHRVRPGPVPHSQEPESEDMELPLEGYVPEGLELAALRPESPAPEEQECHNHSPDG      1 - 70
DSSSDYVNNTSEEEDYDEGLPEEEEGITYYIRYCPEDDSYLEGMDCNGEEYLAHSAHPVDTDECQEAVEE     71 - 140
WTDSAGPHPHGHEAEGSQDYPDGQLPIPEDEPSVLEAHDQEEDGHYCASKEGYQDYYPEEANGNTGASPY    141 - 210
RLRRGDGDLEDQEEDIDQIVAEIKMSLSMTSITSASEASPEHGPEPGPEDSVEACPPIKASCSPSRHEAR    211 - 280
PKSLNLLPEAKHPGDPQRGFKPKTRTPEERLKWPHEQVCNGLEQPRKQQRSDLNGPVDNNNIPETKKVAS    281 - 350
FPSFVAVPGPCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANSE    351 - 420
GDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSASQDCIETTPGA    421 - 490
QEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDIINTQEMYNDDLIHF    491 - 560
SNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILANMMNGGPAARSGKLSIGDQIMSINGTSLVGLP    561 - 630
LATCQGIIKGLKNQTQVKLNIVSCPPVTTVLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRI    631 - 700
IEINGQSVVATAHEKIVQALSNSVGEIHMKTMPAAMFRLLTGQETPLYI                         701 - 749
//

Text Mined References (45)

PMID Year Title
24742670 2014 Mint proteins are required for synaptic activity-dependent amyloid precursor protein (APP) trafficking and amyloid ? generation.
24385013 2014 Circulating methylated MINT2 promoter DNA is a potential poor prognostic factor in gastric cancer.
24009623 2013 Genome-wide association study for biomarker identification of Rapamycin and Everolimus using a lymphoblastoid cell line system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23076970 2012 Gene expression changes in peripheral blood from Chinese Han patients with Tourette syndrome.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22222501 2012 Promoter characterization and genomic organization of the human X11? gene APBA2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20029827 2009 Copy number and sequence variants implicate APBA2 as an autism candidate gene.
20016085 2009 Novel mediators of amyloid precursor protein signaling.
20015385 2009 Increased epithelial stem cell traits in advanced endometrial endometrioid carcinoma.
19744962 2009 X11beta rescues memory and long-term potentiation deficits in Alzheimer's disease APPswe Tg2576 mice.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19222704 2009 Phosphorylation of the amino-terminal region of X11L regulates its interaction with APP.
19197363 2009 A genome-wide investigation of SNPs and CNVs in schizophrenia.
17989066 2008 Comparative genome hybridization suggests a role for NRXN1 and APBA2 in schizophrenia.
17332754 2007 The novel cargo Alcadein induces vesicle association of kinesin-1 motor components and activates axonal transport.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15699037 2005 RNA interference-mediated silencing of X11alpha and X11beta attenuates amyloid beta-protein levels via differential effects on beta-amyloid precursor protein processing.
15563604 2005 Munc18-1 regulates early and late stages of exocytosis via syntaxin-independent protein interactions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14970211 2004 Facilitation of stress-induced phosphorylation of beta-amyloid precursor protein family members by X11-like/Mint2 protein.
12972431 2003 Novel cadherin-related membrane proteins, Alcadeins, enhance the X11-like protein-mediated stabilization of amyloid beta-protein precursor metabolism.
12780348 2003 XB51 isoforms mediate Alzheimer's beta-amyloid peptide production by X11L (X11-like protein)-dependent and -independent mechanisms.
12720574 2003 Partial duplication of the APBA2 gene in chromosome 15q13 corresponds to duplicon structures.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11083918 2000 X11 alpha and x11 beta interact with presenilin-1 via their PDZ domains.
11036064 2000 Mints as adaptors. Direct binding to neurexins and recruitment of munc18.
10833507 2000 Regulation of X11L-dependent amyloid precursor protein metabolism by XB51, a novel X11L-binding protein.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10777610 2000 PDZ domain-dependent suppression of NF-kappaB/p65-induced Abeta42 production by a neuron-specific X11-like protein.
10336668 1999 Mint2/X11-like colocalizes with the Alzheimer's disease amyloid precursor protein and is associated with neuritic plaques in Alzheimer's disease.
9890987 1999 Interaction of a neuron-specific protein containing PDZ domains with Alzheimer's amyloid precursor protein.
9860131 1998 Mint 3: a ubiquitous mint isoform that does not bind to munc18-1 or -2.
9822620 1998 Identification of an evolutionarily conserved heterotrimeric protein complex involved in protein targeting.
9614075 1998 The X11alpha protein slows cellular amyloid precursor protein processing and reduces Abeta40 and Abeta42 secretion.
9585438 1998 Mapping of the human and murine X11-like genes (APBA2 and apba2), the murine Fe65 gene (Apbb1), and the human Fe65-like gene (APBB2): genes encoding phosphotyrosine-binding domain proteins that interact with the Alzheimer's disease amyloid precursor protein.
9395480 1997 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis.
9110174 1997 Large-scale concatenation cDNA sequencing.
8955346 1996 The intracellular cytoplasmic domain of the Alzheimer's disease amyloid precursor protein interacts with phosphotyrosine-binding domain proteins in the yeast two-hybrid system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7545337 1995 The PTB domain: a new protein module implicated in signal transduction.