Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.79
PubTator Score 1.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.037 4.3e-06
adult high grade glioma -1.400 1.9e-05
astrocytic glioma -1.100 2.6e-03
Astrocytoma, Pilocytic -1.400 1.1e-08
atypical teratoid / rhabdoid tumor -1.500 8.5e-07
colon cancer 1.600 3.0e-03
glioblastoma -1.300 2.8e-09
intraductal papillary-mucinous carcinoma... 1.400 4.4e-02
intraductal papillary-mucinous neoplasm ... 2.000 2.0e-02
lung cancer 1.200 4.1e-03
medulloblastoma -1.200 1.3e-04
medulloblastoma, large-cell -1.200 2.9e-04
osteosarcoma -1.127 1.6e-03
ovarian cancer 1.400 7.6e-05
pancreatic ductal adenocarcinoma liver m... 1.363 1.0e-02
primitive neuroectodermal tumor -1.200 3.4e-04
tuberculosis -1.100 1.7e-03

Gene RIF (6)

AA Sequence

MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVI      1 - 70
QTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTIL     71 - 140
RTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACV    141 - 210
KLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQNLVAIPVYVKHNI    211 - 280
SFRDSSSLGRFEITVGPKQTMGKTIEGVTVTSQMPKGVLNMSLTPSQGTHTFDPVTKMLSWDVGKINPQK    281 - 350
LPSLKGTMSLQAGASKPDENPTINLQFKIQQLAISGLKVNRLDMYGEKYKPFKGIKYMTKAGKFQVRT      351 - 418
//

Text Mined References (9)

PMID Year Title