Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.75
PubTator Score 6.92

Knowledge Summary


No data available


  Differential Expression (12)

Disease log2 FC p
posterior fossa group A ependymoma -2.900 3.3e-18
astrocytoma -1.500 2.4e-18
glioblastoma -2.100 6.4e-04
oligodendroglioma -1.200 4.8e-10
atypical teratoid / rhabdoid tumor -3.000 2.8e-11
medulloblastoma, large-cell 1.500 1.0e-04
adult high grade glioma -2.100 3.9e-05
pilocytic astrocytoma -1.500 2.8e-06
subependymal giant cell astrocytoma -2.450 2.9e-02
lung carcinoma 2.300 1.0e-47
Pick disease -1.800 1.6e-03
pituitary cancer -1.200 5.7e-05

 GO Function (1)

Gene RIF (5)

26643602 Our findings provide direct evidence for the association of FBXO38 and AP3B2 with severe chronic periodontitis in the Han Chinese population.
23305486 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
19481122 Observational study of gene-disease association. (HuGE Navigator)
18076669 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
17453999 A novel splice variant of AP3B2, AP3B2_v2, was isolated by large-scale sequencing analysis of a fetal brain cDNA library; Sequence analysis showed AP3B2_v2 missed 22 exons that existed in AP3B2_upsilon1, encoding a different putative protein

AA Sequence

ARPAGAAQLTVNSEKMVIGTMLVKDVIQALTQ                                         1051 - 1082

Text Mined References (19)

PMID Year Title
26643602 2015 Two-stage comprehensive evaluation of genetic susceptibility of common variants in FBXO38, AP3B2 and WHAMM to severe chronic periodontitis.
23118302 2012 Genome-wide association study evaluating lipoprotein-associated phospholipase A2 mass and activity at baseline and after rosuvastatin therapy.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19481122 2009 Association analysis between schizophrenia and the AP-3 complex genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17453999 2007 Characterization of AP3B2_v2, a novel splice variant of human AP3B2.
16788073 2006 Regulation of large dense-core vesicle volume and neurotransmitter content mediated by adaptor protein 3.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12565890 2003 Centaurin-alpha 1 associates in vitro and in vivo with nucleolin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10930456 2000 The AP-3 complex required for endosomal synaptic vesicle biogenesis is associated with a casein kinase Ialpha-like isoform.
9707615 1998 ATM binds to beta-adaptin in cytoplasmic vesicles.
9545220 1998 Association of the AP-3 adaptor complex with clathrin.
9118953 1997 AP-3: an adaptor-like protein complex with ubiquitous expression.
7671305 1995 Beta-NAP, a cerebellar degeneration antigen, is a neuron-specific vesicle coat protein.
1851215 1991 Antiserum from a patient with cerebellar degeneration identifies a novel protein in Purkinje cells, cortical neurons, and neuroectodermal tumors.